KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_174853Help
Entry
PHYPADRAFT_174853 CDS       T01041                                 

Gene name
SDG1518
Definition
histone methyltransferase Su3-9 group
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PHYPADRAFT_174853 (SDG1518)
Enzymes [BR:ppp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PHYPADRAFT_174853 (SDG1518)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 533 aa AA seqDB search
MNFEASLNDEAQPNDLDSELYRQRRKRYADLLHFYQQLQEKGESNERIRPDLEATKKMQE
EKMNFDWKGVGHVPGSIVGDFFFYRTELFVLGLHRAMQAGIAYTEVGQEKIGCSIVASGG
YEDDEDHGETMIYTGHGGNNKADRRQVKDQKPEGGNLALLNSLKYKQPVRVIRGHSDIPT
SQSPSKKIYSYDGLYQVVDQSLELGASGFKVFKFKLERLPNQRELGSRLVSFVGKLNKAP
SIRTGVVIEDLSGGQEPIPVSVVNTVDDTRPPSSFEYTTKLRYPKGVSLRSSTGCSCKGD
SCHSVGHRCSCVLKNSGKMLPYNQYGHLIRAVPAVYECGSRCKCSLECHNRVCQKGLRYR
LEIFKTEKKGWAVRSWDFIPSGGFVCEYTGVIMDTKTADELDDDDYLFNLDFKQGNEARW
GVQRSDVFDSDDSDMPPLKLSSPKYVIDASKFGGVARFVNHSCTPNLFVQCVLYDHGDLD
LPHVMLFAGSDISPFQELTYDYGYALNSVYDSHGNLKKKDCHCGTRSCRKRLY
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaggcctccttgaatgacgaagctcaacccaatgatctagattctgagcta
taccgacagagacgaaaaaggtatgctgatctcttgcatttctaccaacaattgcaggag
aagggagagtcaaatgagagaattagaccagatcttgaagctaccaaaaaaatgcaggag
gagaaaatgaactttgactggaaaggagttgggcatgttccaggtagtattgtgggcgat
ttcttcttctatagaactgagctatttgtcctgggcttacaccgagccatgcaagcaggc
attgcttacactgaggtggggcaggaaaagattgggtgcagcatagtagcctctggcggc
tacgaagacgatgaagatcatggtgagacaatgatttacactggacacggtggaaacaat
aaagccgacagacggcaagtgaaggaccagaaaccagagggaggaaaccttgccctcctg
aatagtttgaagtataagcagcctgtgcgcgtgatacgtggccactctgacattccaacc
agccaaagcccttctaagaagatatattcttatgatggattgtatcaggtcgtagatcaa
tccttagaactgggagcatccggcttcaaggtgttcaagttcaaacttgaacggctcccc
aaccagagagagctagggtctaggttggtttccttcgtgggcaagttgaacaaggcaccg
tcgatacgcactggcgtggtgatagaagacctgtcaggagggcaggaaccaatccccgtt
tctgttgtcaataccgtggatgatactagacccccttcttctttcgaatataccacgaag
ctgcgttatcccaaaggcgtgtcgttgcgttcctctacaggttgctcttgcaagggtgat
tcatgtcacagcgtaggtcatcggtgctcctgtgtgcttaagaattccggcaaaatgttg
ccctacaatcaatatggacatttgattcgggctgtgccagctgtgtacgagtgcggtagt
cggtgcaaatgctctctagagtgccataacagggtctgtcagaaaggactgcggtaccgc
ctcgagattttcaaaactgagaaaaaaggctgggcggtaaggtcatgggacttcattccg
tccggtgggtttgtttgcgaatatactggcgtgatcatggacacaaagactgcagatgag
cttgatgatgatgactacctcttcaacctggattttaagcaaggtaatgaggcacgctgg
ggagttcaacgatcggacgtctttgacagtgacgactctgacatgcctccacttaagctg
agttctccgaagtatgttatcgatgccagcaaatttggtggcgttgcacggtttgtcaac
cacagttgtacgccaaaccttttcgtgcaatgtgtgctttatgatcacggtgaccttgat
ctccctcacgtgatgctctttgcaggtagtgacattagtccctttcaggaattgacgtat
gactatggctatgcccttaactctgtctatgattcacatgggaatctgaagaagaaggat
tgtcactgtggtacccggagttgcagaaaaaggctgtattag

DBGET integrated database retrieval system