KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_174853Help
Entry
PHYPADRAFT_174853 CDS       T01041                                 

Gene name
SDG1518
Definition
histone methyltransferase Su3-9 group
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ppp00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 533 aa AA seqDB search
MNFEASLNDEAQPNDLDSELYRQRRKRYADLLHFYQQLQEKGESNERIRPDLEATKKMQE
EKMNFDWKGVGHVPGSIVGDFFFYRTELFVLGLHRAMQAGIAYTEVGQEKIGCSIVASGG
YEDDEDHGETMIYTGHGGNNKADRRQVKDQKPEGGNLALLNSLKYKQPVRVIRGHSDIPT
SQSPSKKIYSYDGLYQVVDQSLELGASGFKVFKFKLERLPNQRELGSRLVSFVGKLNKAP
SIRTGVVIEDLSGGQEPIPVSVVNTVDDTRPPSSFEYTTKLRYPKGVSLRSSTGCSCKGD
SCHSVGHRCSCVLKNSGKMLPYNQYGHLIRAVPAVYECGSRCKCSLECHNRVCQKGLRYR
LEIFKTEKKGWAVRSWDFIPSGGFVCEYTGVIMDTKTADELDDDDYLFNLDFKQGNEARW
GVQRSDVFDSDDSDMPPLKLSSPKYVIDASKFGGVARFVNHSCTPNLFVQCVLYDHGDLD
LPHVMLFAGSDISPFQELTYDYGYALNSVYDSHGNLKKKDCHCGTRSCRKRLY
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaggcctccttgaatgacgaagctcaacccaatgatctagattctgagcta
taccgacagagacgaaaaaggtatgctgatctcttgcatttctaccaacaattgcaggag
aagggagagtcaaatgagagaattagaccagatcttgaagctaccaaaaaaatgcaggag
gagaaaatgaactttgactggaaaggagttgggcatgttccaggtagtattgtgggcgat
ttcttcttctatagaactgagctatttgtcctgggcttacaccgagccatgcaagcaggc
attgcttacactgaggtggggcaggaaaagattgggtgcagcatagtagcctctggcggc
tacgaagacgatgaagatcatggtgagacaatgatttacactggacacggtggaaacaat
aaagccgacagacggcaagtgaaggaccagaaaccagagggaggaaaccttgccctcctg
aatagtttgaagtataagcagcctgtgcgcgtgatacgtggccactctgacattccaacc
agccaaagcccttctaagaagatatattcttatgatggattgtatcaggtcgtagatcaa
tccttagaactgggagcatccggcttcaaggtgttcaagttcaaacttgaacggctcccc
aaccagagagagctagggtctaggttggtttccttcgtgggcaagttgaacaaggcaccg
tcgatacgcactggcgtggtgatagaagacctgtcaggagggcaggaaccaatccccgtt
tctgttgtcaataccgtggatgatactagacccccttcttctttcgaatataccacgaag
ctgcgttatcccaaaggcgtgtcgttgcgttcctctacaggttgctcttgcaagggtgat
tcatgtcacagcgtaggtcatcggtgctcctgtgtgcttaagaattccggcaaaatgttg
ccctacaatcaatatggacatttgattcgggctgtgccagctgtgtacgagtgcggtagt
cggtgcaaatgctctctagagtgccataacagggtctgtcagaaaggactgcggtaccgc
ctcgagattttcaaaactgagaaaaaaggctgggcggtaaggtcatgggacttcattccg
tccggtgggtttgtttgcgaatatactggcgtgatcatggacacaaagactgcagatgag
cttgatgatgatgactacctcttcaacctggattttaagcaaggtaatgaggcacgctgg
ggagttcaacgatcggacgtctttgacagtgacgactctgacatgcctccacttaagctg
agttctccgaagtatgttatcgatgccagcaaatttggtggcgttgcacggtttgtcaac
cacagttgtacgccaaaccttttcgtgcaatgtgtgctttatgatcacggtgaccttgat
ctccctcacgtgatgctctttgcaggtagtgacattagtccctttcaggaattgacgtat
gactatggctatgcccttaactctgtctatgattcacatgggaatctgaagaagaaggat
tgtcactgtggtacccggagttgcagaaaaaggctgtattag

DBGET integrated database retrieval system