KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_176083Help
Entry
PHYPADRAFT_176083 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PHYPADRAFT_176083
Peptidases [BR:ppp01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PHYPADRAFT_176083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 323 aa AA seqDB search
MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLELESLSQLRPVYGLVFLFKWRAGEKDG
RPVLKDYNPNLFFASQVINNACATQAILSILMNRPEIEVGPELSTLKEFTRGFPPELKGL
AINNSEAIRTAHNSFARPEPFVAEEQKVADKDDDVYHFISYLPVDGVLYELDGLKEGPIS
LGECGGEGPDSMDWLQMVQPVIQERIEKYSKSEIRFNLMAVIKNRKDIYNEEMTQLEMRR
ARLWDRIEKLEGKRDDTMDFADVESELAKVQDKIAMEDEKFRKWKTENIRRKHNYIPFLF
NFLKILAEKKQLRPLIEKARQKT
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtgtacaattgagtcggatccaggggtattcacggaattgattcaacaaatg
caagtgaaaggggttcaggtggaagagctttatagtttggaactcgaatccctttcacag
ctcaggccagtgtacggtcttgtttttttgttcaaatggcgagctggggaaaaggatggc
cggcctgtattgaaggactataacccaaatctcttcttcgccagccaggttatcaacaat
gcatgcgcaacacaggctatactctcaatcctcatgaacaggccggagatagaggttgga
ccagaactctcaacattgaaggaattcacgcggggtttcccccctgagttgaaggggctg
gccatcaacaacagtgaagctattcgcacggctcacaacagtttcgccagacctgaacca
tttgtggcagaggaacagaaagttgcagacaaagatgatgacgtgtaccacttcatcagc
tatttgcctgttgatggtgttctatatgagctcgatggactaaaggagggccccatcagt
ttaggcgaatgcggcggtgaaggccccgattctatggactggctgcagatggtgcaaccc
gttattcaagagagaattgagaagtattccaagagtgagatcaggttcaacctcatggct
gttataaagaatagaaaggatatatataatgaagagatgacacagcttgaaatgaggcga
gctcggttgtgggatcgcatagagaagctggaaggaaagcgggacgatacaatggacttt
gctgatgtggagtcagagcttgctaaagtgcaagataagatagccatggaggatgagaag
tttcgcaagtggaagactgagaacattcgcaggaagcataactatatccctttcctgttc
aattttctcaagattttggcagagaagaagcagctgagacctttgattgagaaggctcgt
cagaaaacttga

DBGET integrated database retrieval system