KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_177951Help
Entry
PHYPADRAFT_177951 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHYPADRAFT_177951
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHYPADRAFT_177951
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PHYPADRAFT_177951
Enzymes [BR:ppp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PHYPADRAFT_177951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 487 aa AA seqDB search
MAMAALAPAQATSPIASCQAVLKPSALKDARHSKINALYSSLNGTACVFTCDSPLRKGAS
VSHGHVRCTLAEDVHTRDRDDVRTYKGYERPDSFGRYGVYGGKYVPETLMAALSNLEVAY
RATIKDPEFQKELNGVLKDYVGRETPLYFAERLTEHYKRDGKGPLIYLKREDLNHTGAHK
INNAIAQALLAKRIGKKRIIAETGAGQHGVATATVCARFGLECIVYMGAQDMERQALNVF
RMRLLGAEVRPVNSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVRDFHAM
IGTEVRRQAMEKWGGKPDILVACVGGGSNAMGLFHEFIEDEETRLIGVEAAGFGTNTDKH
AATLTMGEIGILHGAMSYLLQDADGQIIEPHSISAGLDYPGVGPEHSFLKDVGRAEYFSV
TDDEALEAFQRLSKLEGIIPALETSHALAFLEKLCPTLEDGTRVVLNCSGRGDKDVNSVI
GYLKGKY
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggctatggcggcattggcaccagctcaagccaccagccccatcgcttcatgtcaagct
gtactcaaaccctcggcattgaaggatgcgaggcactcaaagattaatgctttgtattct
tctctgaacgggactgcgtgcgtgtttacatgcgactcgcctcttaggaagggagcttca
gtttctcatggccatgtgcgctgcacccttgcggaggatgtgcataccagggatcgagat
gatgtccgaacctacaaaggctatgaacgtcctgactcctttgggagatatggtgtctat
ggagggaaatacgtccctgagacccttatggctgctcttagtaatctggaggtagcatat
cgtgcaacaatcaaggatcccgaattccagaaggagcttaatggcgtgcttaaggactac
gtgggcagggaaacccctctgtactttgctgaacgcctaactgagcactataagcgtgac
gggaaaggtcccttgatttatcttaagcgggaggaccttaaccacactggcgctcacaag
atcaacaacgccattgcccaagctttgttggcgaagcggattggaaagaagcgcattatt
gctgagacaggggcaggtcagcacggtgttgccacagctacagtatgtgctcgctttgga
ctcgagtgcattgtatacatgggtgcccaggatatggaaagacaagctttgaatgtattc
cgaatgcgtcttcttggagctgaggttcgtcctgtaaattctggcactgccaccttgaaa
gatgcaacctcagaggctattcgtgactgggttacgaatgtggaaacgactcattatatt
cttggctcagttgctgggccgcacccgtaccctatgatcgtgagagactttcatgcaatg
atcggaactgaggttcgtcgccaggcaatggaaaagtggggtggaaagccggatattctt
gtcgcttgtgttgggggaggctcaaatgcaatggggttattccacgaatttatcgaagat
gaagaaactcgtctcattggtgttgaagcagctggctttggtactaatacagacaagcac
gctgccaccttgaccatgggagaaattggtatcttacatggtgcaatgagctatttgctc
caggatgctgatggccagattattgaaccacattcaattagtgcgggattggattaccca
ggtgttggtccagagcacagtttcctgaaggatgttggtcgagcagagtacttcagcgtg
actgatgatgaagccctggaagcattccagaggttgtccaagctggagggtatcattccg
gcactggagacatctcatgccctagctttcttggaaaaactttgccctacacttgaagac
ggtacccgagtggtcctcaattgcagtggtcgtggtgacaaggatgtcaacagcgtcatt
ggttacttgaaaggaaagtactga

DBGET integrated database retrieval system