KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_178131Help
Entry
PHYPADRAFT_178131 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PHYPADRAFT_178131
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PHYPADRAFT_178131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 517 aa AA seqDB search
MLARTGRGSAVRVISKQASVSTPTKESAVEKEAYDCVVVGAGISGLCTAQALATRHGSVV
GNVLVTEARDRVGGNITTVQGDGFLWEEGPNSFQPNDSMLAAAIDSGLKDELVLGDPKSP
RYVLWGGRLRPVPAGPADLPFFDLLSIFGKLRAGFGAMGLRPGAPGREESVQEFVTRNLG
QEVFERLIEPFCSGVYAGDPSKLSMKAAFGKVWKLEEIGGSIIGGTIKMIQERQKNPPPP
RDERLPKPKGQTVGSFKKGLITLPNAIAAQLGDKVKLNWKLTTIKKTDAGYALTYETPEG
TKTVQARSLVLTVPAYIAKEILRPLSEGAAEALSQFYYPPVCACTISYPLSALREDRLTD
GKLFGFGQLHPRSQGVQTLGTIYSSSLFPNRAPEDRVLLLNYIGGAQYPQIMEKSDEEIV
KTVDKDLRTMLLKPDAPAPQMHGVRTWPKAIPQFTIGHLDHLESAKNALQNAKLDGLFLG
GNYVVGVALGRCVEGAYESAQAISQYVATTTAKTSSV
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgaggaccggaagggggagtgctgtgcgagtgatcagcaagcaagcgtccgtg
tccacacccacgaaggagagtgcggttgagaaggaggcttatgattgcgtcgtggtgggg
gccggaatttcgggtttgtgtactgcgcaggctctcgctactagacatggatctgtagta
ggcaatgttctggtcacggaagcaagagatcgagtgggaggaaacatcacaacagttcag
ggtgatggatttctgtgggaggagggccccaacagcttccaacctaacgattcaatgttg
gccgcagcgatagatagcgggttgaaggatgaattggtcttgggagatccaaaatcccct
cgatacgtgttgtggggtggccgattgcggcctgtgcctgcaggtccagctgatttacct
ttcttcgacctactcagcatctttggaaagcttcgggctggttttggagctatgggattg
aggcctggagctccaggccgtgaggagtcagtgcaggagtttgtgactcgtaatctgggc
caggaggtctttgagcggctgattgagcctttctgttctggtgtgtacgccggagatcct
tcgaaattgagcatgaaagctgccttcggtaaggtatggaagttggaagaaataggtggg
agtattattggaggcacaattaaaatgattcaagaaaggcaaaaaaatcctccacctcct
cgtgatgaacgactccccaaaccaaagggtcagaccgttggttcctttaaaaaggggttg
attactcttccaaatgcaatcgctgcacaattaggtgataaagtgaagcttaattggaag
cttaccaccattaagaagaccgatgctggctacgccttgacatacgagacacctgaagga
acaaagaccgtgcaagcacgttctctagttctcactgtgccggcgtacattgctaaggag
attctgcgccccctctctgaaggggcagccgaagcgctttctcaattttactaccctccg
gtttgtgcctgcactatctcgtaccccttgtcagctctacgtgaagaccggctgacagac
ggaaagctgtttggatttgggcagcttcacccccgtagtcaaggtgtgcagacactaggt
accatttacagctcctccttatttcctaatcgggctccagaggatcgtgtactactgctc
aattacatcggtggtgctcaatacccacaaattatggagaagagtgacgaggaaatcgtg
aagacggtggataaggacctccgaacaatgctcttgaaacccgatgcccctgctccacaa
atgcacggagtacgaacttggccaaaggccatacctcagtttaccattggccatctcgat
catttagaatctgcgaaaaatgcgttgcaaaatgcaaagttggacgggctgtttttggga
ggaaactatgtagtgggtgtggccctgggtcgatgtgttgaaggtgcatatgaaagtgcg
caggctatttcacaatatgtcgctacgacaacagcaaagactagttcagtatga

DBGET integrated database retrieval system