KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_179979Help
Entry
PHYPADRAFT_179979 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PHYPADRAFT_179979
   00052 Galactose metabolism
    PHYPADRAFT_179979
   00500 Starch and sucrose metabolism
    PHYPADRAFT_179979
   00520 Amino sugar and nucleotide sugar metabolism
    PHYPADRAFT_179979
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PHYPADRAFT_179979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 474 aa AA seqDB search
MASAVLDAPATTKVDQLDRIRLELATLNQISDNEKQGFLKLIGRYLSGKSEAIQWENIKA
PTDEVVVPYDKLADFSDDPVKIKSLLDKLAVLKLNGGLGTTMGCTGPKSVIEVRNGLTFL
DLIVKQIENLNHTYNANVPLVLMNSFNTHEDTLQIVERYADSKLEVITFNQSQYPRVVAE
DMVPWPAKGKTDNAGWYPPGHGDVFPSLANTGKLDELIAQGKEYVFIANSDNLGAIVDLK
ILNHLVENQNEYCMEVTPKTLADVKGGTLISYEDRVQLLEIAQVPDEHVNEFKSIDKFKI
FNTNNMWVNLKAIKRLVEADALQMEIIPNPKEVDGVKVLQLETAAGAAIRFFDRAIGVNV
PRSRFLPVKATSDLLLVQSDLYTVQNGAVVRNRARTIPQNPSIELSGEFKKVGDFLKRFK
SIPSIIELDSLKVSGDVWFGENIVLKGKVIVEAAKGEKLVLPDDATIEDKVVKE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggccgtgcttgatgctcctgctaccaccaaagtcgatcagctcgatcggatt
cgcctcgagttggctacgctcaaccagatcagcgataatgaaaagcaaggatttcttaaa
ctcattggacgatatttgagtgggaagagtgaagcgattcaatgggagaatatcaaggct
ccaaccgatgaggttgtcgttccgtatgacaagttggccgatttctccgatgatccagtc
aaaattaagtcgcttcttgacaagcttgcagtgcttaagctcaacggaggtcttggaaca
acaatgggatgcactggtccaaagtctgttattgaggttcgcaacggtttgacatttttg
gacctgattgtgaagcaaatcgagaatctcaaccacacttacaacgccaacgtacccctg
gtcttgatgaactcattcaatacccacgaagatactttacagatcgttgaaagatatgcg
gactcgaagctggaggttatcactttcaatcagagccagtaccctcgcgttgttgcagag
gatatggttccatggcctgccaagggcaagacagacaacgctggttggtacccacccggt
catggtgacgtgttcccttcactcgctaacactggaaagctcgacgagcttattgcccag
ggcaaggagtacgtgtttattgccaattctgacaatttgggagcgattgttgacctcaaa
attttgaaccatctggtcgagaaccagaacgagtattgcatggaagtcacaccaaagacc
cttgctgatgtcaagggtggaactttgatctcttacgaagacagggttcagcttctggaa
atcgcacaggttcctgatgagcatgtgaatgagttcaagtcaatcgacaaattcaaaatt
ttcaacaccaacaacatgtgggtaaatttgaaggccatcaagaggctggtcgaagccgat
gctttgcaaatggaaattattccgaaccccaaggaagtagatggcgtgaaagttcttcag
ctggaaacagctgcgggtgctgcaattcggttcttcgatagggcaattggtgtgaacgtt
cctcgatctcggttccttcccgtgaaggctacatcagacttactgttggttcagtcagat
ttgtatacagtgcaaaatggtgcagttgtgcgcaaccgtgcaagaaccattcctcagaat
ccttccattgagctcagtggcgaattcaaaaaggttggtgattttttgaagcgatttaag
tcaattcccagcatcattgagttggactctttaaaagttagcggagatgtatggttcggc
gaaaacatcgtcttgaaggggaaggtgatagttgaggcagccaagggtgagaaactggtg
ctacctgacgacgctaccatcgaggacaaggtggtcaaagaataa

DBGET integrated database retrieval system