KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_180457Help
Entry
PHYPADRAFT_180457 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PHYPADRAFT_180457
Peptidases [BR:ppp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PHYPADRAFT_180457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1115 aa AA seqDB search
MTVIAAPPEEDDDMLVPPQDFNDVIEPMEVVGQGEGVVTVENQLVDDPQTGKFTWPIENL
SKINLRKHYSETFTVGGYKWRVLLFPKGNNVDHLSIYLDVADSAQLPYGWSRFAHFTLAV
VNQIDPKLTVKKDTQHQFNVRESDWGFTSFMPLHDLNDPSRGFVVNDTLIVEADVNVRKV
VDYWAYDSKKETGFVGLKNQGATCYMNSLLQTLYHLPYFRKAVYHMPTTENDVPSNSIPL
ALQSLFYKIQYSDTSVATKDLTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGTAVEG
TIQQLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCKDVYESFDKYVEVERLEGENK
YHAEQFGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPLQLDLDRENG
KYLSPDADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWFKFDDERVTKEELKRA
LEEQYGGDEELPQTNPCFNNTPFKFTKYSNAYMLVYIREADKDKVVCNVDEKDIAEHLQI
RLKKEQEEKERKRKEKAEAHLYTIIKVGRDEDLQNQIGKDIHFDLVDHEKVRSFRIQKQT
PFTQFKEEIAKQLGVPVECQRFWLWAKRQNHTYRPNRPLTDQEEAQTVGHLKEASNKAHN
AELKLFLEVQRLPGADSVPIPPPIKTKEDVLLFFKLYNPEKEELRYVGRSYVKASGRPAD
ILERLNEMAGFPPNEEIQLYEEIKFEPNVMCEHIDKKSTFRASQLEDGDIICYQRALTRG
EEDVCRYPDVPSFLEYVRNRQNVHFRRLEKPKDDEFCLELSKQHTYDDVVERVAEKIGLE
DASKIRLTSHNCYSQQPKPQPIKYRGVERLSDMLVHYNQTSDILYFETLDLPLPELQGLK
TLKVAFHNAKTEELSVHNIRLPKQSTVGDVVNELKGKVELSSPRAELRILEVFYHKIYKI
FPLNEKIENINDQYWTLRAEEVPDEEKELGPQDRLIHVYHFTRDASQNHMVQNFGEPFFL
VVRESETLVEVKGRIQKKLLISDEEFSKWKFAFLSLGRPEYLQDGDVVAARFQKRDTYGA
WEHYLGLEHTDSAPKRSHTTNQNRHNFEKPVKIYN
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcatcgcggcaccgcctgaagaggacgatgatatgttggtgcctccccaggac
ttcaacgacgtgattgaaccgatggaagtggtagggcaaggagaaggtgttgttactgtg
gagaatcagcttgtggatgatcctcagacgggaaaattcacgtggccaatagagaatctt
tcgaaaattaatttgagaaagcattactcagaaacatttaccgttggtggttacaaatgg
cgggtgctgttatttccgaaaggcaataatgtggatcatctttcgatatacttggatgtt
gctgattctgcacaactaccctatggctggagcagatttgcacattttactcttgccgtt
gtaaatcagattgatccaaagttgactgtcaagaaagatactcagcatcagttcaatgta
cgtgaaagtgactggggattcacatcgttcatgcctttacatgacttgaatgatccatca
cgaggtttcgtggtgaatgatactcttattgtagaagctgatgtgaatgttcgtaaggtg
gttgattattgggcgtacgattcgaagaaggaaacaggatttgttgggttaaagaatcaa
ggagctacatgctacatgaattctctcctccagacattgtatcatctgccttacttccgg
aaggccgtgtatcatatgccaactactgagaatgatgttccatccaacagcattcctcta
gctctgcagagcttattctacaaaattcagtatagtgacactagtgttgcaacgaaggat
cttactaagtctttcggatgggatacatacgactcctttatgcaacatgatgttcaggag
ctcaatcgagttctctgtgaaaagttggaagataaaatgaagggtaccgctgttgagggc
acaattcaacaactgtttgaaggtcatcatatgaactacatagagtgtatcaatgttgac
tacaagtcaacacgcaaagagtcattttatgatttgcagcttgatgtgaaagggtgcaag
gatgtttatgaatcttttgacaagtatgtcgaggtagaacgcttggaaggcgagaacaag
tatcacgcagaacaattcggattgcaggatgcaaaaaaaggagtcctatttatagacttc
ccccctgttcttcagctccaactgaaacggtttgaatacgacttcatgcgagacacaatg
gtgaagattaatgatcgctatgagtttcctctgcaactagacctggatagagagaatgga
aaatatctctctcctgatgctgaccgcagtgtgcgaaatttatacacattgcacagtgta
ctggtccacagtggtggggttcatggtggtcattactacgcttttattagacccacgctc
tctgaccagtggttcaaatttgatgatgagcgagttacgaaagaggaactcaagagagct
cttgaggagcaatatggaggggatgaggagcttccacaaacgaatccgtgtttcaataac
acgcccttcaagttcacgaaatattcgaacgcatacatgttggtgtatatcagagaggct
gataaagacaaggttgtttgtaatgtggatgagaaagacattgcagaacacttacagata
aggttgaagaaagagcaggaggagaaggaacggaagaggaaggaaaaggctgaggcccac
ctttacactatcataaaggttgggcgcgatgaagatctccagaaccagattggaaaggac
attcattttgatttggtggatcatgagaaagttcgcagttttcgcatccagaagcaaacg
cctttcacgcagttcaaggaagaaatcgcaaagcagcttggcgtccctgttgagtgccaa
aggttctggctctgggcaaagcgccaaaaccacacatatcgtcctaacagaccactaact
gatcaagaagaggcccaaactgttgggcacttgaaagaagcctccaacaaggctcacaat
gctgagctaaagctcttcttggaagtgcagcgcctccctggtgcagattcagttcccata
cctcctccaatcaaaacaaaagaggacgtgcttttgtttttcaaactgtacaatcctgag
aaggaggaattgcgttatgttggtagatcttatgtaaaggcgagtggtagaccagccgat
atcttggaacggctgaatgagatggctggctttcctccgaatgaggagattcagttgtat
gaggaaattaagttcgaacctaatgtcatgtgcgagcacatcgacaagaaatctaccttc
agggccagccagttggaggatggtgatatcatctgctaccagagagctctaacaagggga
gaagaagatgtttgccggtatcctgacgtcccatcgtttttggagtatgttcgtaaccga
cagaatgtgcacttcagacgtctggagaaaccgaaggatgacgaattttgtttggaattg
tcaaagcaacacacatatgatgatgtggttgagagggtagcagagaaaattggtctggag
gatgcatcaaaaatcaggctaacatcacacaattgctactctcagcaaccaaaaccacaa
cctatcaagtatcgtggcgttgagcggctcagtgatatgctcgtacattataatcagact
tcagatatcctgtattttgagacgttggatttgccacttcctgagcttcagggcctgaaa
accctgaaggtggctttccacaacgctaaaacagaagagctttcagttcacaatattcgg
cttcccaaacagagcacggttggggatgttgtgaacgaactgaaggggaaggttgaactt
tcgagtccaagagcagagcttcgcattcttgaagtattctatcacaaaatttataagatc
tttcctcttaatgagaaaatagagaatatcaatgatcagtactggaccctgcgagctgaa
gaggttcctgacgaggagaaagaactcggtccccaagatcgtttgattcatgtgtaccac
tttacacgggatgcatcacaaaatcatatggttcaaaattttggagaaccattttttctc
gtagttcgtgagagtgagactttggtagaggtgaagggacgcatacagaaaaagctgttg
atttctgatgaggaattttccaagtggaagtttgcctttctttcactgggtcgacctgag
tatcttcaagacggcgatgtagttgcggctcgttttcagaaacgagacacatacggtgca
tgggaacattatttggggctggaacatactgacagtgcacctaagcgatcacacaccaca
aaccagaaccgtcacaatttcgaaaaacctgtaaagatctataactga

DBGET integrated database retrieval system