KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_180723Help
Entry
PHYPADRAFT_180723 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppp00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
AA seq 603 aa AA seqDB search
MCGILAILGADGAVPSAGRDRALALSRRLRHRGPDWSGLFEGKDSWCYLAHERLAIIDPA
SGDQPLYNGTKDIVVAANGEIYNHELLKKNMKPHEYHTQSDCEVIAHLYEDVGEEVVNML
DGMWSFVLVDSRDNSFIAARDPIGITPLYLGWGADGRTVWFASEMKALKDDCERLEVFPP
GHIYSSKAGGLRRYYNPQWFSETFVPETPYQPLELRSAFEKAVVKRLMTDVPFGVLLSGG
LDSSLVASVAARHLAETKAVRIWGNELHSFCVGLEGSPDLKAAREVAKYIGTRHHEFNFT
VQEGLDALSDVIYHVETYDVTTIRASTPMFLMTRKIKALGVKMVLSGEGSDEIFGGYLYF
HKAPNREEFHHELVRKIKALHLYDCQRANKSTSAWGLEARVPFLDKEFMDVAMMIDPSEK
MIRKDLGRIEKWVLRKAFDDEERPYLPKHILYRQKEQFSDGVGYSWIDGLKEYAESHVTD
QMMKHAKHVYPFNTPNTKEGYYYRMIFEKHFPQQSARMTVPGGPSVACSTATAVAWDEAW
ANNLDPSGRAALGCHDSAYTDKHSEKAAPAAEANGTASHENGHTFSKPKSTLDATILKTQ
AVH
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattctagcgattctcggtgccgacggcgccgttccgtctgccggacgtgat
cgcgctctagcgctgtcccgaaggctgcgccatcgaggacctgactggagtggactcttt
gagggcaaggattcctggtgttacctcgctcatgagcgcctggctatcatcgatccggct
tcgggtgatcaacccctctacaatggcactaaggacatcgttgtcgctgctaacggagag
atttacaaccacgagttgttgaagaagaacatgaaaccacacgagtaccacacgcagtcc
gattgcgaagtcattgctcatctttatgaggatgtaggtgaggaggttgtgaacatgctt
gacggcatgtggtcgttcgtgctggtggacagccgagacaactccttcatcgcagcccgc
gaccccatcggcatcactcctctctatcttggttggggagccgatggtagaactgtgtgg
tttgcctcggagatgaaagccttgaaggacgattgcgaacggcttgaggtctttccacca
ggccacatctactcaagcaaagctggagggctccgtcgctactacaacccacagtggttc
tcagagacttttgttcccgaaactccttaccagcctctggaactacgttcagccttcgag
aaggctgtggtaaagaggctcatgaccgacgtccccttcggtgtgctcctttccggaggc
ttggattcttccttggtggcatcagtggcagcccgacatcttgccgaaaccaaagctgtc
agaatctggggcaacgagctccactccttctgtgttggccttgagggttctcccgacctg
aaggctgcgagggaagttgccaagtacatcggcacccgccaccacgaatttaacttcacc
gtccaggaaggattggacgctctgtctgacgtgatctaccatgtggagacctacgacgtg
accaccattagggcgagcacaccaatgttcctcatgacacggaagatcaaggctctgggt
gtgaagatggtgttgtctggggagggatccgacgagatctttggtggttacctctacttc
cacaaagctcccaacagggaggagtttcaccacgaactagtccgcaagatcaaggcgcta
cacttgtacgattgccagagagccaacaaatcaacctctgcttggggtctggaagctcgt
gttcccttccttgacaaggagttcatggacgttgcgatgatgatcgaccctagcgagaag
atgatcaggaaggacctgggcagaattgagaagtgggtgctgcgtaaagctttcgatgac
gaagagagaccatacttgcccaagcacattttgtacaggcaaaaggagcaattcagcgat
ggagtgggctacagctggattgatggactcaaggaatatgcggagagccatgtgacggat
cagatgatgaagcacgcgaagcatgtgtaccccttcaacacgcccaacaccaaagaagga
tattactaccgaatgatcttcgagaagcatttcccccaacaatccgcccggatgacggtc
cccggaggtccttcggtagcatgcagcaccgccacagctgtggcatgggacgaagcatgg
gccaacaacttggacccctccggcagagcagcattgggatgccatgactcagcttacaca
gacaaacacagtgagaaagctgcaccagcggcagaagctaacggcacggcttctcacgag
aacggccacacattctccaagcccaaatccacactggatgccaccattctgaaaactcag
gccgtgcactaa

DBGET integrated database retrieval system