KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_181532Help
Entry
PHYPADRAFT_181532 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 346 aa AA seqDB search
MSRRVRRGGLRVAVPKQETPVSKFLTASGTFQDDDIKLNHTGLRVVSSEPNLPTQTQSSS
PDGQLSIADLELVRFLGKGAGGTVQLVRHKWTNVNYALKAIQMNINETVRKQIVQELKIN
QVTHQQCPYIVECFHSFYHNGVISMILEYMDRGSLSDIIKQQKQIPEPYLAVIASQVLKG
LEYLHQVRHIIHRDIKPSNLLINHKGEVKISDFGVSAVLVHSLAQRDTFVGTCTYMSPER
LQGRSYAYDSDLWSLGLTLLECALGTFPYKPAGMEEGWQNFFILMECIVNQPPAAASPDK
FSPEFCSFIESCIRKCPSERPSTTDLLKHPFLQKYNEEEYHLSKIL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggagagtgagaaggggaggtcttcgcgtcgcggtgccgaagcaagagactccc
gtcagcaaatttttgactgccagtggaactttccaggatgatgatatcaagctcaaccac
accgggcttcgcgtcgtctcttcagaacctaaccttcctacgcagacgcagtctagctcc
ccagatgggcaactgtcaatagcagacctggagttagtgcggttcttaggaaagggtgcg
ggtggaaccgtgcagcttgtccggcacaaatggaccaatgtcaattatgcactgaaggcg
atacaaatgaatatcaacgaaacagtgaggaagcagattgttcaggagctgaaaatcaac
caagtgacgcaccagcagtgcccttatatcgtggaatgcttccactccttctaccacaac
ggcgtcatatccatgatcctagagtacatggacaggggctcgttgtccgacattattaag
caacaaaagcagatacctgagccgtatttggccgtcattgctagtcaagttctgaaggga
ttggaatacctacaccaagtcaggcacatcatacatcgtgatataaagccctccaacctc
ctcatcaatcacaagggtgaggtcaaaatatctgattttggtgtcagtgctgtgttggtt
cattccttggcccagcgagacacgttcgttgggacttgcacatatatgtcgccagaacgc
cttcaggggcgttcgtatgcatacgacagtgacctatggagtttaggattgactcttttg
gagtgtgcgttgggtaccttcccatacaaaccagctggaatggaagagggttggcaaaat
ttcttcatcctcatggaatgtatagttaatcaaccccccgcagccgcatcccctgacaaa
ttctcccccgaattttgttcttttattgaatcctgcatccggaaatgtcccagtgaacga
ccatcaactactgatttacttaaacatccgttcctgcaaaagtacaacgaggaagagtac
catttgagcaagattttgtaa

DBGET integrated database retrieval system