KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_185258Help
Entry
PHYPADRAFT_185258 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ppp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppp00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ppp00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ppp00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppp00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 491 aa AA seqDB search
MGSTSKVSAGDGGAVLEDVPHLTDWLPDLPTYENPLKHNPAYAAVRQYFIEDTDVVAKDV
VVNINTAGDGVHFRRAGPRDKIYFQSEDVKACIVTCGGLCPGINTVIREIVCGLWTQYGV
REIFGIDGGYKGFYSRNTISLNPKVVSDIHKRGGTFLKSSRGGHDTKKIVDSIEDREFNQ
VYIIGGDGTHKGASAIHEECKKRGLKVAVAGIPKTIDNDLDVIDKSFGFDTAVEEAQRAI
NAAHVEAESVHNGIGLVKLMGRYSGYIALYATLASRDVDLCLIPEVPFYLLGPGGLIEYV
HHRLKENGHMVIVVAEGAGQELIAESMGSFKNLNDASGNKLLLDVGLWLCQNLKEHFLKE
FKEPLNLKYIDPTYMIRAVPSNASDNVYCTLLAHSAIHGAMAGYCGFTVGPVNVRHCYIP
IPRVVAKSRHVNVADRMWARLMSSTNQPSFSQYNEIIIQKRQEEALRGGGAPTSANGTTT
MVICHSQVHSL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgggttccacgagtaaggtatccgcaggagacggtggtgccgtacttgaagatgtaccg
caccttactgactggcttcccgacctgccgacatacgaaaatccattgaagcacaatcca
gcatacgcggccgtgaggcagtattttatcgaggacacagatgtcgttgccaaagatgtg
gtagtaaatatcaacactgctggggatggtgttcatttcagacgtgcaggacctcgtgat
aagatatacttccagtcggaggatgtgaaggcatgcattgtaacttgtggaggattatgc
cccggaatcaatactgtgattcgtgagattgtctgtggtctgtggacgcaatatggtgtg
cgcgaaatctttggtattgatggaggatacaaaggattttactctcggaacacaatctct
ctcaatcctaaagttgtgagtgatattcataaacgaggaggcacgtttttgaaatcttca
cgtggtggacacgacaccaaaaaaattgttgattctattgaagaccgtgaattcaatcag
gtttatattattggaggtgatggcactcacaaaggggcttccgctatccacgaggagtgc
aagaagaggggtctgaaggttgcggttgcgggcattcccaaaacaatcgataatgatctc
gatgtcatagacaaatcatttggttttgataccgcagttgaagaagcacagcgtgcaatt
aatgctgcgcacgtggaagctgagagtgttcataatggcattggattggtcaagcttatg
ggacgatacagtggttacattgctttgtatgccactcttgcaagtcgtgatgtggactta
tgcttgattccagaagtgccgttctacttactcgggccaggtggactgatcgagtatgtt
caccatagattaaaagaaaatggtcacatggtcatcgtggtggctgagggtgctggacaa
gaattgatcgctgagagcatggggtctttcaaaaatctcaatgatgcatctggaaataaa
ttacttcttgatgtcggtttatggctctgtcaaaatctgaaggaacattttctcaaggaa
tttaaggagccgctgaacttgaaatacatagatccaacgtacatgattcgagctgttcca
agcaatgcttctgacaacgtgtactgcactttgcttgctcatagcgccatccatggagct
atggcagggtattgcggtttcactgttggacctgttaacgtcagacattgctatatccca
ataccacgagtggtggcgaagtcgcgacacgtaaacgtagctgatcgcatgtgggcgcgg
ctaatgtcatcaaccaaccaaccaagcttttctcaatacaacgaaataattatacagaag
cgtcaagaggaagctttgaggggaggtggtgcaccaacatctgcaaacggcaccaccaca
atggtaatttgccatagtcaggttcattctttgtga

DBGET integrated database retrieval system