KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_185258Help
Entry
PHYPADRAFT_185258 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHYPADRAFT_185258
   01230 Biosynthesis of amino acids
    PHYPADRAFT_185258
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHYPADRAFT_185258
   00030 Pentose phosphate pathway
    PHYPADRAFT_185258
   00051 Fructose and mannose metabolism
    PHYPADRAFT_185258
   00052 Galactose metabolism
    PHYPADRAFT_185258
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PHYPADRAFT_185258
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PHYPADRAFT_185258
Protein phosphatases and associated proteins [BR:ppp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PHYPADRAFT_185258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 491 aa AA seqDB search
MGSTSKVSAGDGGAVLEDVPHLTDWLPDLPTYENPLKHNPAYAAVRQYFIEDTDVVAKDV
VVNINTAGDGVHFRRAGPRDKIYFQSEDVKACIVTCGGLCPGINTVIREIVCGLWTQYGV
REIFGIDGGYKGFYSRNTISLNPKVVSDIHKRGGTFLKSSRGGHDTKKIVDSIEDREFNQ
VYIIGGDGTHKGASAIHEECKKRGLKVAVAGIPKTIDNDLDVIDKSFGFDTAVEEAQRAI
NAAHVEAESVHNGIGLVKLMGRYSGYIALYATLASRDVDLCLIPEVPFYLLGPGGLIEYV
HHRLKENGHMVIVVAEGAGQELIAESMGSFKNLNDASGNKLLLDVGLWLCQNLKEHFLKE
FKEPLNLKYIDPTYMIRAVPSNASDNVYCTLLAHSAIHGAMAGYCGFTVGPVNVRHCYIP
IPRVVAKSRHVNVADRMWARLMSSTNQPSFSQYNEIIIQKRQEEALRGGGAPTSANGTTT
MVICHSQVHSL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgggttccacgagtaaggtatccgcaggagacggtggtgccgtacttgaagatgtaccg
caccttactgactggcttcccgacctgccgacatacgaaaatccattgaagcacaatcca
gcatacgcggccgtgaggcagtattttatcgaggacacagatgtcgttgccaaagatgtg
gtagtaaatatcaacactgctggggatggtgttcatttcagacgtgcaggacctcgtgat
aagatatacttccagtcggaggatgtgaaggcatgcattgtaacttgtggaggattatgc
cccggaatcaatactgtgattcgtgagattgtctgtggtctgtggacgcaatatggtgtg
cgcgaaatctttggtattgatggaggatacaaaggattttactctcggaacacaatctct
ctcaatcctaaagttgtgagtgatattcataaacgaggaggcacgtttttgaaatcttca
cgtggtggacacgacaccaaaaaaattgttgattctattgaagaccgtgaattcaatcag
gtttatattattggaggtgatggcactcacaaaggggcttccgctatccacgaggagtgc
aagaagaggggtctgaaggttgcggttgcgggcattcccaaaacaatcgataatgatctc
gatgtcatagacaaatcatttggttttgataccgcagttgaagaagcacagcgtgcaatt
aatgctgcgcacgtggaagctgagagtgttcataatggcattggattggtcaagcttatg
ggacgatacagtggttacattgctttgtatgccactcttgcaagtcgtgatgtggactta
tgcttgattccagaagtgccgttctacttactcgggccaggtggactgatcgagtatgtt
caccatagattaaaagaaaatggtcacatggtcatcgtggtggctgagggtgctggacaa
gaattgatcgctgagagcatggggtctttcaaaaatctcaatgatgcatctggaaataaa
ttacttcttgatgtcggtttatggctctgtcaaaatctgaaggaacattttctcaaggaa
tttaaggagccgctgaacttgaaatacatagatccaacgtacatgattcgagctgttcca
agcaatgcttctgacaacgtgtactgcactttgcttgctcatagcgccatccatggagct
atggcagggtattgcggtttcactgttggacctgttaacgtcagacattgctatatccca
ataccacgagtggtggcgaagtcgcgacacgtaaacgtagctgatcgcatgtgggcgcgg
ctaatgtcatcaaccaaccaaccaagcttttctcaatacaacgaaataattatacagaag
cgtcaagaggaagctttgaggggaggtggtgcaccaacatctgcaaacggcaccaccaca
atggtaatttgccatagtcaggttcattctttgtga

DBGET integrated database retrieval system