KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_185446Help
Entry
PHYPADRAFT_185446 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHYPADRAFT_185446
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHYPADRAFT_185446
   00020 Citrate cycle (TCA cycle)
    PHYPADRAFT_185446
   00620 Pyruvate metabolism
    PHYPADRAFT_185446
Enzymes [BR:ppp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PHYPADRAFT_185446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 553 aa AA seqDB search
MPALSPTMTQGNVGNWKKQEGDRVAAGDVLCDIETDKATLDFETLEDGILVKILMPSGSR
DVPVGKALCVIAESEEDVAKFASYSEGGDQSAPQASAPKQQAPVSSSSAPCPRTPPADLP
PHQILAMPALSPTMTQGNVGTWRKKEGDQIAAGDVLCDIETDKATLDFESLEDGYLAKII
IPSGSKDVQVGMELCIIAESGEDLDKFASYSDASASAATTSVSKPTETAYEPTPAPMTSS
TVKGNIGPAVKKLLAESGLNVSQIQGTGPGGMIIKGDVLAAIKGGMKPLAGDKAGDKVKG
AAAQTDAAAPKSAPSKAPTPDTSLTFEDIPNTPIRKIIAKRLLESKNIIPHAYVQSDTTL
DATLRFRKYLKDTHGINVSVNDFVIKAAALALKEVPDANAFWDDKVGDRVNNNSIDISIA
VATDKGLITPILKNADQKSLSTISAEVKTLVEKARNGKLKPHEFQGGTFSISNLGMFQVD
HFCAIINPPQACILAVGRGVQKVVWDEDSNGPKTVTQMLVTISVDHRVYGGDTASQFLAA
FRKNLANPQRMLL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgccagctttatctccaacaatgactcaaggaaatgttggaaactggaagaaacaggaa
ggagatagggtagccgcaggggatgttttatgtgacatcgaaactgacaaagccacgctt
gactttgaaacgctggaagatggaatcctggtcaaaattttgatgccatctggttccagg
gatgttcctgtcggcaaagcactttgtgtaattgcagagagtgaggaggacgtggccaag
tttgctagctacagtgaaggaggagatcaatctgcacctcaagcttctgctcccaaacaa
caagcgcccgtttcttcgtcctctgctccgtgtccaaggacaccaccggctgacctccca
cctcaccaaatcctggcgatgcctgcactatctccaactatgacacaaggtaatgttgga
acctggagaaagaaggaaggagaccagatagcagctggtgatgtgctctgcgacattgaa
actgacaaggctacgttggactttgagtctttggaagatggttatctggctaaaattatt
attccatctggaagcaaggatgtgcaagttggcatggagctttgtatcattgcggaatca
ggtgaggatcttgacaaatttgcatcctacagtgatgcatcagcttcagcggccacaact
tctgtcagcaaacctactgaaactgcatatgaaccgactccagcccccatgaccagttca
actgtgaagggtaacataggtcctgcggttaaaaaacttctcgccgaaagtggactaaat
gtctcacaaatacaaggcacgggccctggtggcatgattattaaaggtgatgtattggct
gctattaaaggtggtatgaaaccactagcaggtgacaaagcaggtgacaaagtgaaaggt
gctgctgcccagacagatgctgctgctccgaaaagtgcaccatctaaagcaccgacacct
gatacctcattgacttttgaagacatacctaatactccaatccgcaagattattgcgaag
aggcttcttgaatccaagaacatcatacctcatgcctacgtgcaatcagacacgactctg
gacgctacgttacggttcagaaaatatctaaaagacacgcatggcatcaatgtttcagta
aatgatttcgtcatcaaggctgctgcacttgctttgaaggaggttcctgatgccaatgcg
ttttgggatgataaagtaggggatcgagtaaacaacaactccatcgacatatcaatagct
gttgctacggacaagggcttgataacaccaatcctgaaaaatgcggatcaaaagtctttg
tcaacaatttcggcggaggtgaaaacattagttgagaaggctcggaatgggaagttgaaa
cctcatgaatttcaaggtggcacattcagtatatcgaatctgggcatgttccaagtggac
cacttttgtgctattatcaacccgcctcaggcatgcatacttgcggttggtaggggcgta
cagaaggtggtttgggatgaagacagcaatggtccgaagaccgtgacgcaaatgttggta
actatatctgtggatcaccgggtatatggaggtgatacagcaagtcagttcttggcggca
ttccggaagaatttggctaatccgcagagaatgttgctataa

DBGET integrated database retrieval system