KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_185890Help
Entry
PHYPADRAFT_185890 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 382 aa AA seqDB search
MSEDIDKHVLRKYHVGQKLGKGAYGIVWKAVDRRSNEVVALKKIFDAFQNSTDAQRTFRE
VMFLQEMNDHENIIKLLNVLKAENDRDLYLVFEYMETDLHAVIRANILEEIHKQFIMYQL
FKALKFMHSGELLHRDIKPSNLLLDSECQVKVADFGLARSVAQLKEDAGNSPAVLTDYVA
TRWYRAPEILLGSTQYTFGVDMWSSGCILGELLNGKPVFPGTSTMNQIEKILEVIGRPAP
DDIAALQSPFAATMLDSMPIDPKPFLQVFPKASSEAEDLLRKLLHFNPFKRITAENALRH
PYLAQFHNPIDEPICSRIIRIPIDDNTKLTISEYRERLYAEIVHRKKEIRKKLREKERLS
RELSPGQRRPKPRSGGSASTNR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagacatcgacaagcatgtgcttcgaaaataccacgtcggacagaaacttggt
aaaggggcgtatggtatcgtttggaaagccgtcgatagaaggagcaatgaagttgtggct
ctcaaaaagatatttgatgcgtttcaaaactcaactgatgcccagagaacctttcgagag
gtgatgtttcttcaagagatgaatgaccatgagaacatcattaaattattgaacgtattg
aaagcggagaatgaccgagatctttatcttgtgtttgagtacatggaaacggatttgcat
gctgtgataagggcaaacattctagaggaaattcataaacagtttataatgtatcaactt
ttcaaggctttgaaattcatgcattctggagagttacttcatcgggacatcaagccaagt
aacttgttactcgactcggagtgtcaagtgaaggttgcagactttggactcgcgcgatcg
gttgcgcaattgaaggaagatgctggaaattcacctgctgttctgacagactatgttgca
actcgttggtatcgagcacctgagatacttcttgggtctacccaatatacttttggagtt
gacatgtggtccagtggctgtatacttggagaacttctgaacggaaaacctgtttttcct
ggaacatcgacgatgaaccagattgagaagatactggaagttattggaagacctgctccg
gatgatatcgctgccctccaatctccatttgcagcaaccatgttggacagtatgcccatc
gaccccaagcctttcctccaagtgtttccaaaagcctcgtccgaagcagaggatttgcta
aggaaattgctacatttcaatccgttcaaacgcattacagcagagaatgctctgcgacat
ccatacctagcccagtttcacaatccaattgatgagcctatctgcagtcgaatcatacgc
atacctattgatgacaacaccaagctcacgattagtgaataccgtgaaagactctatgca
gagattgttcatcggaagaaggaaatccgcaagaagcttagagaaaaagagagactgagc
cgtgagttatctcctggtcaacgaaggcctaaacctcgttcaggtggcagtgcgagtacg
aatcgctga

DBGET integrated database retrieval system