KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_186747Help
Entry
PHYPADRAFT_186747 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PHYPADRAFT_186747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 113 aa AA seqDB search
MASFAEAPKGNEKAGEKIFKTKCAQCHAVEKSAGHKQGPNLHGLFGRTSGTTAGYTYSKA
NRDKAVDWNEEHLYEYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKKSTSE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggcctctttcgctgaggcccccaagggtaacgagaaggccggtgagaagatcttcaag
accaagtgcgcgcaatgtcacgctgttgagaagtccgctggccacaagcaaggacctaac
ttgcatggtttgttcgggaggacgtcgggaactacagctgggtacacttactcgaaagct
aacagggacaaggctgttgattggaacgaggagcatctatacgagtacctattgaatcct
aagaagtatattcctggtacgaagatggtattccctggtttgaaaaaacctcaagaacgt
gcagatctaatcgcttatttaaagaaatcgacctcagagtag

DBGET integrated database retrieval system