KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_186751Help
Entry
PHYPADRAFT_186751 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    PHYPADRAFT_186751
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PHYPADRAFT_186751
Protein phosphatases and associated proteins [BR:ppp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     PHYPADRAFT_186751
Transcription machinery [BR:ppp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     PHYPADRAFT_186751
Spliceosome [BR:ppp03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PHYPADRAFT_186751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 321 aa AA seqDB search
MDIAVLDDIIVRLLEVRTGRPGKQVQLSEAEIRQLCVASKDIFLSQPNLLELEAPIKICG
DIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRG
NHECASINRIYGFYDECKRRFNIRLWKTFTDCFNCLPVAALIDEKILCMHGGLSPDLKNL
DQIKKIARPTDVPDAGLLCDLLWADPDKDVATWGDNDRGVSYTFGPDTVSEFLQTHDLDL
ICRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPAEKKQ
KFVSYGNNASRPGTPPRVVKG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcggtattggatgatattattgtgcggctgctcgaggtgcggactgggagg
ccgggcaagcaagtgcagctgtcggaggctgaaatccgtcagctctgtgttgcatcgaag
gacatatttttgtcccagcctaatcttctcgagctcgaggctccaattaagatttgtggt
gatatccatggtcaatattctgacctcttgaggttgttcgaatatggtggcttcccacct
gaggctaattacctatttttaggggattatgttgacagaggaaaacagagtctagaaact
atctgtcttcttttggcatataaaatcaagtacccagagaacttctttttgttaagaggt
aaccacgaatgcgcatcaatcaatcggatatacggcttctacgatgaatgtaaacgtcgt
ttcaacatccggctgtggaagacgtttacggattgtttcaattgcttgcccgtggctgct
ttaattgatgagaagattctttgcatgcatggaggcctctctccagatctcaagaacttg
gaccagattaagaagattgcacgacctacagatgttcccgatgcaggcttgttgtgtgac
cttctatgggcggaccctgataaagatgtggcgacgtggggagacaatgaccgaggagtc
tcctatacatttggtccagacactgtctcagagtttctacaaacccacgacttggatctc
atctgtcgagcccatcaagtagtagaggatggttatgaatttttcgctaagcgccaactg
gttaccattttttctgctccaaattattgtggtgaatttgataatgcgggtgcaatgatg
agtgtggacgatactctcatgtgctcgtttcagatcctaaaaccagcagaaaagaaacaa
aagtttgtttcatacggaaataatgcctcacgacctggaaccccgcctcgtgtagttaag
ggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system