KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_186759Help
Entry
PHYPADRAFT_186759 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PHYPADRAFT_186759
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PHYPADRAFT_186759
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PHYPADRAFT_186759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 170 aa AA seqDB search
MAGSKEAGQTIYDFVVKDIDGSDVELSKYRGKVLLIVNVASKCGLTTTNYKELADVYTKY
KSQDFEILAFPCNQFGGQEPGTNEQIKEFACTRFKAEYPIFDKINVNGPQEAPLYKYLKL
QKGGGWLLGDSIKWNFAKFLVDKNGNVVDRFAPTTPPSKIEKSIETYLSR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtcaaaagaagccggccaaacgatttacgacttcgttgtgaaggacatcgac
ggcagcgatgtcgagttgagcaagtacaggggcaaggtgctgttgattgttaacgttgcg
tcgaagtgcgggttgacgactaccaattacaaagagctcgcggacgtgtacactaaatac
aagagtcaggattttgagattttggcattcccttgcaatcagttcggaggacaggagcct
gggacgaatgagcagatcaaggaatttgcgtgcacgaggtttaaagccgagtaccctatt
ttcgacaagatcaatgtgaatggtcctcaggaggcaccactctacaagtatttgaagttg
cagaaaggaggcggatggttgttgggggatagcattaagtggaatttcgccaagtttctc
gtggacaagaatgggaacgtcgtggaccgctttgcacccactactcctccttcaaagata
gagaagtctatcgaaacttatttgagcaggtag

DBGET integrated database retrieval system