KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_186759Help
Entry
PHYPADRAFT_186759 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ppp00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ppp00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 170 aa AA seqDB search
MAGSKEAGQTIYDFVVKDIDGSDVELSKYRGKVLLIVNVASKCGLTTTNYKELADVYTKY
KSQDFEILAFPCNQFGGQEPGTNEQIKEFACTRFKAEYPIFDKINVNGPQEAPLYKYLKL
QKGGGWLLGDSIKWNFAKFLVDKNGNVVDRFAPTTPPSKIEKSIETYLSR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtcaaaagaagccggccaaacgatttacgacttcgttgtgaaggacatcgac
ggcagcgatgtcgagttgagcaagtacaggggcaaggtgctgttgattgttaacgttgcg
tcgaagtgcgggttgacgactaccaattacaaagagctcgcggacgtgtacactaaatac
aagagtcaggattttgagattttggcattcccttgcaatcagttcggaggacaggagcct
gggacgaatgagcagatcaaggaatttgcgtgcacgaggtttaaagccgagtaccctatt
ttcgacaagatcaatgtgaatggtcctcaggaggcaccactctacaagtatttgaagttg
cagaaaggaggcggatggttgttgggggatagcattaagtggaatttcgccaagtttctc
gtggacaagaatgggaacgtcgtggaccgctttgcacccactactcctccttcaaagata
gagaagtctatcgaaacttatttgagcaggtag

DBGET integrated database retrieval system