KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_187470Help
Entry
PHYPADRAFT_187470 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PHYPADRAFT_187470
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     PHYPADRAFT_187470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 505 aa AA seqDB search
MFPERRSILDWDNTSDKWKEHAFHETATSRGVHGRVPVFVMLPLDSVNMNNTLNRRRALN
ASLMALKSAGIEGIMMDVWWGIVEKDAPLNYNWSAYRELIEMARKHGLKVQAVMSFHQCG
GNVGDSCNIPLPPWVLEEIQKNPDLAYTDKSGRRNAEYICLGADNVPALKGRTPVQCYAD
FMRSFRDNFEDLLGDVIIEIQCGMGPAGELRYPSYPESEGRWRFPGIGEFQCYDKYMLAG
LKASAEAVGMPAWGTSGPHDAGNYNQWPDDTGFFRKDGTWSTDYGQFFMEWYSEMLLAHG
ERILSVATGIFRDTEAVISGKVAGIHWHYGTRSHAAELTAGYYNTRTRDGYAPIAQLFAK
YGVTLNFTCFEMRDLEQPSHALCSPEGLVKQVAFATRTAGTPMAGENALPRFDSSAHEQI
ITSSRLRMPVEGDCHQDYEPMAAFTFLRMSESMFHSENWRLFVPFVRHMEEGRTFQPWEE
EHQRTETHVKATGPLVQEAASLMLH
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtttccagagcgtagatccattctggactgggataacacgtcggataagtggaaagaa
cacgcattccatgagacggcaacgagcagaggtgtccatggccgtgtgcccgtgttcgtg
atgttaccgttggacagcgtgaatatgaataatactctgaacaggcgtcgagcgttgaat
gcctccttgatggctttgaaatctgctggcattgaagggattatgatggatgtctggtgg
gggattgttgagaaagatgcgcccctgaattacaattggtctgcatatcgtgagttaatc
gagatggcgcgaaagcacgggttgaaggtgcaggctgttatgtcctttcatcaatgtggc
ggtaatgttggggatagttgcaacattcccctacctccatgggttcttgaagagatacag
aagaatcctgacctggcctacaccgacaagtcaggaagacgtaatgctgagtacatttgt
cttggtgccgacaacgtgccagccctgaagggaaggacacctgtacagtgctacgctgac
tttatgaggagtttcagagacaacttcgaagatctccttggagatgttatcattgaaata
caatgtggaatgggaccagctggcgaacttcgctacccttcatatccggaaagtgaagga
aggtggcgattcccaggtataggcgagttccaatgttatgataagtacatgcttgcgggt
ttgaaagcgagtgcggaggctgtgggcatgcctgcttggggcactagtggtcctcacgat
gctggaaactacaaccaatggcccgatgatactggtttcttccgcaaggatggtacatgg
tctacagactacggacagttcttcatggagtggtattctgaaatgcttcttgctcatggt
gaacgcatcctatcagtggctactggcatcttcagggatactgaagctgttatttcaggc
aaagttgctggtattcattggcactacggcacaagaagtcatgccgccgagctaacagca
gggtattataacactcggacaagggacggatatgctcccattgcccagctattcgcgaag
tatggcgttacactgaacttcacatgttttgaaatgcgagaccttgagcagccttcccat
gctttatgcagtccggagggtttagtgaaacaagtagcttttgctactaggacagctgga
accccaatggccggagagaacgctcttcctagatttgacagttcagcacacgaacagata
atcacctcgtcgaggttgcgtatgcctgtagaaggagactgtcatcaagattatgaacct
atggctgccttcacctttctgagaatgtctgaaagcatgtttcacagcgaaaactggaga
ctgtttgttccattcgttcgtcacatggaggagggtcgtacgtttcaaccatgggaagaa
gagcaccaaagaacagaaactcatgtaaaagccactggacccttggttcaagaagcagcc
tcgttgatgttacattag

DBGET integrated database retrieval system