KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_187864Help
Entry
PHYPADRAFT_187864 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ppp00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppp00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 370 aa AA seqDB search
MAGLGYTVCLLVTVALVCSAEPAQGSQKVPETREEVIASFASWVQRVGEKHAAWERAAKT
ATTADEFASKVGETVIVVDQSGAGNFKTVNEALNSIPEHSKSPVTIKVNAGTYNERVVIP
KSKEFITLQGAGRDVTKITASNAAGNSGTTYTSATFGVSAPHFTARNISFENSSPPPDGG
AQQQAVALRTTGDMNAFYGCAFYGHQDTLYDHRGRHFFKDTLIVGTVDFIFGDGKSLYKN
CELRVLPSSGGSLTAQKRLSGSEDTGYSFVNCKVTGSGPPQVYLGRAWGPYSRVIFAFTE
FANIIKPEGWYNWGDPSREKTVFYGMYKCFGPGASSPSRAYYSKELTDAEAAPFLSLNYI
DGGLWVKEGI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggctggccttgggtacactgtatgcctcttggtgactgtggcattagtatgctccgca
gagcctgcgcaaggttcccagaaggtccccgaaaccagggaggaagtgatcgccagcttc
gcaagctgggttcagagagtaggagagaagcatgccgcctgggagcgagctgccaagacc
gctaccaccgctgacgagtttgctagcaaggtcggcgaaaccgtgattgtggttgatcag
agtggagctggaaacttcaagactgtcaacgaagctttgaattctatcccggagcacagc
aagtcaccggtcactattaaagtgaacgccggaacttataatgagagggtggttattccc
aagtctaaggagttcatcacattgcaaggcgcaggtcgtgatgttaccaaaatcacagca
agcaatgcagctggtaactctggtacaacgtacacatcggcgacgtttggcgtcagcgca
cctcacttcaccgccagaaacatcagttttgagaactcgtctcctcctcccgacggcgga
gctcagcaacaagccgtggcgctacggaccaccggtgacatgaacgccttttacggatgt
gccttctatggtcaccaagacacactgtacgaccatagaggccgccacttcttcaaggat
actctcatcgtcggcactgtggacttcatttttggcgacggaaagtctctgtacaagaac
tgcgagctgcgcgtgttgccgtcctcaggtggctcgttaacagcccagaaaagactgagt
gggagtgaggacactggctactcgtttgtgaattgcaaagttaccggctccgggccgcct
caagtgtacctcggccgtgcctggggtccctattctcgtgtgatctttgctttcactgaa
ttcgccaacatcatcaaacccgaaggatggtataactggggagacccctccagggaaaag
actgtgttctacgggatgtacaagtgcttcggccccggtgctagctccccgtcgagagct
tactactcaaaagagcttacggatgccgaggctgcaccattcctgagcctcaactacatt
gatggggggctttgggtgaaggaaggaatctaa

DBGET integrated database retrieval system