KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_188285Help
Entry
PHYPADRAFT_188285 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PHYPADRAFT_188285
Enzymes [BR:ppp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PHYPADRAFT_188285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 592 aa AA seqDB search
MKKWKLGVGIGEDLPAKYQDDDPLKQAPRRRCGILLHPTSLPGPNGIGDFGKDTYRFLDW
LKETGCTVWQVLPLVPPGTRGGEDGSPYAGSNANCGNTLLISLEELVKDGLLEKTDLPKP
LPVKRMDSSKVAAIKNPLILKAAAKLVSKSSGKLKEELERFRKDPKISVWLEDAALFASI
DQCTLAKTWWTWPTQLRDRDPNAMKTVRIKHKSDIDNFIAAQFLFHRQWQSVHKYANAAG
IKILGDMPIYIGGHSADVWAHRALFELDPKTGVPMQVSGVPPDAFSATGQLWGSPLYNWK
EMAKDRYAWWATRLRRAYELYDEFRIDHFRAFAGYWAIPATAQNAMGGKWKAGPGSAFFT
AMREAVGKIDVIAEDLGIITGDVIALRKEIKAPGMAVLQFAFSDNAANPHLPHNHELDQV
VYPGTHDNDTCVGWWKKASDAEKQVARAHLRFEGDADVHWEFIRGAVASVARTSIVSMQD
VMGLDSASRMNIPATQAGNWGWRVGESDVFESLGEETSRLRELMCRYHRATLDAESTTSK
GATRDKRSSLDALGRAIKNIIGDKLGNSGNNSNLECQGNNNGANLEKPKDKP
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatggaaattaggtgtaggaataggagaagatttgcctgcgaagtatcaagat
gatgatcccctgaagcaagcacctcgaagaaggtgcggcattcttttacatccaacttca
ttgccaggacctaatggaattggagacttcggcaaggacacgtatagattcttagattgg
ttgaaagaaactggatgcaccgtctggcaggttttgcctttagttcctccgggaacaaga
ggaggagaagatggttcaccatacgccggatctaatgccaattgtggaaacaccttactc
atttctttagaggaactcgtgaaagacggattgttggaaaaaactgatctgccgaaacct
cttccagtgaaacgtatggattcttccaaagtcgcggctataaaaaatcctctcatattg
aaagccgcagctaaacttgtgagcaaaagctcaggaaaactcaaagaagagttagaaagg
ttcagaaaggacccgaagatctctgtgtggttggaagatgcagcactgtttgcttctata
gatcaatgcacactcgcgaagacgtggtggacgtggccaactcaacttcgagacagagat
ccaaatgccatgaagacagtccgcataaaacacaagagcgacatcgacaacttcattgca
gcccaatttctcttccaccgtcaatggcaatccgtccacaagtacgccaacgccgcgggc
atcaaaatcctcggcgacatgccaatatacataggaggccattcggcagacgtttgggct
cacagggcactgttcgaactagacccaaaaaccggagtacccatgcaagtcagcggcgtg
ccgcccgacgcgttcagtgcaacggggcagttgtgggggagccctctgtacaactggaaa
gaaatggccaaagacagatacgcatggtgggccacgaggctacgacgggcgtacgagctc
tacgacgagttccgaatcgaccacttccgcgcattcgcaggctactgggcgatcccagcc
acggcacagaatgcgatgggagggaagtggaaggcaggcccgggcagcgcgttcttcaca
gccatgagagaagccgtgggcaagatcgacgtgatcgcggaggacctgggcatcatcaca
ggggacgtgatcgccctgcggaaggagatcaaggcaccgggcatggcggtgctgcagttc
gccttcagcgacaacgccgcgaacccccatctcccgcacaaccacgagctcgatcaggtc
gtgtaccccgggacccacgacaacgacacgtgtgtggggtggtggaagaaggccagcgac
gcggagaagcaggtcgcgagggcccatcttcgcttcgagggcgacgcggatgtgcactgg
gagttcatccgcggcgctgtggcgtccgtggcgcgcaccagcatcgtctccatgcaagac
gtgatgggcttggacagcgcgtcgcgcatgaacatcccagcgacgcaggccggcaactgg
ggctggcgcgtcggcgagtccgacgtcttcgagtccctcggggaggagacgtcgaggctg
cgggagctgatgtgtcggtaccaccgtgccacgctggacgcggagagcaccacgtcgaag
ggtgccacgcgggacaagcgatcctcgctggatgcgctcgggcgagccataaagaacatc
attggggacaaactcgggaactcggggaacaattccaatctcgaatgtcaagggaacaac
aatggtgcgaatctggagaaacccaaggacaaaccctaa

DBGET integrated database retrieval system