KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_188612Help
Entry
PHYPADRAFT_188612 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHYPADRAFT_188612
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PHYPADRAFT_188612
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PHYPADRAFT_188612
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHYPADRAFT_188612
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PHYPADRAFT_188612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 388 aa AA seqDB search
MVVANLDQAVTQPQLPAETELIIEKKGVGRFATMNRPRVLNCINLPMLEEIAEAYEQWEE
DDSVGFIVLKGAGRVFCAGGDLKTFYGLGKSDESWTAMVYIKYWLDYHIATFKKPLVAIW
HGLVMGGGAGLSVTGTFRVATEKTIFAMPEAGIGLHTDCGASYWLSRLSGFLGDYLGLTG
HRLDGAEMYACGLATHFVPLQSLSELEKRLSELSIGDDASVGEVIESFHNPAPISPTSIL
HKQAAINRLFSKGTVEEIVEALEAELEETQETWVKETLKTLRRSSPMGLAVTFKSIRTGR
NESQADTLKREYRLTINALKGTATDDFYEGIRSIVVDKDNAPKWNPKSIQEVTQEQLESV
FMPFKDASKELQLPSEHEPRWSKKFVKV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggtggttgcgaatttggaccaggctgtaacccagccccaacttcctgcggagactgag
ctcatcatcgaaaaaaagggagttgggaggtttgcaacaatgaaccgcccacgagttctg
aactgtatcaacctgcccatgttggaagaaattgcagaagcatacgagcagtgggaagaa
gatgacagcgtaggatttattgtgctgaagggggcaggccgagtattctgcgcaggcggt
gacctcaaaacattctatgggctgggaaagtcagatgaatcttggacagcgatggtatat
atcaagtattggctagactatcacatcgctacattcaagaagccccttgtggctatctgg
cacggcctcgtaatgggaggaggagcagggctgtccgtcacaggaaccttcagagttgcc
accgagaaaactatctttgcaatgccggaagcaggaataggacttcacacagattgtggc
gcttcgtactggctttcacgtctgagcggcttccttggagattacttggggttgacagga
cacagactggatggagcggaaatgtatgcttgcggccttgcaacccactttgttcctctc
cagagtctttcagagcttgaaaagcgtctgtcggagttgtcgattggtgatgatgcttcc
gtcggagaagtcatcgagtccttccacaatccagcccccatttcaccaacaagtattctg
cacaagcaagcagcgataaaccgactattttcaaagggcactgttgaggagatagttgaa
gctctggaggccgagcttgaagagacgcaagagacttgggtcaaggaaaccctcaagacc
ttgcggaggtcatctccgatgggcttagcagtaacattcaaatcgatccggaccggtaga
aacgagtctcaggcggacactctaaagcgggagtaccggctaacaataaatgccttgaaa
ggcaccgcgacggacgatttctacgagggtataagatctatcgtggtggacaaggacaat
gctccgaagtggaatccaaaaagtattcaagaagtgacacaagaacaactcgaatcagtt
ttcatgccattcaaagatgcatcgaaagaattacaactcccatctgagcatgagcccaga
tggagtaaaaaatttgtgaaggtctga

DBGET integrated database retrieval system