KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_189047Help
Entry
PHYPADRAFT_189047 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PHYPADRAFT_189047
Peptidases [BR:ppp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PHYPADRAFT_189047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 271 aa AA seqDB search
MFDDVLRSFSPDQPPRGRPRQEDAQEFLSHVMDRLHEELLWLEGRSIVGQNAVVDDEEWE
IVGPKNKSALTRTHMTIKSPLSDIFGGQLCSVVKAKGNKASATVQPFLVLHLDILSDAVQ
SIEDALRFFAAPESLEGYKAASSKASEVVSASKAIKIQSLPSVLIVHLMRFSYGASGSGK
LNKAIKYSNSLTIGRELLATSTGSATEGRKYELVATVTHHGNNPSTGHYTADCRQPDGRW
LRFDDAVVSVVPINQVLQEHTYVLFYKRVSH
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgatgttctccgcagtttcagccctgatcagcctccacgggggagaccaagg
caggaagacgcccaagaattcctgagtcatgtaatggatcgcctgcatgaggagctgttg
tggcttgagggcagaagtatagttgggcagaatgcagtggttgatgatgaggagtgggaa
atagtaggccctaaaaacaagagtgctttgacccggactcatatgaccataaaatctcca
ctcagtgacatatttgggggccaactctgcagtgttgtgaaggctaaaggcaacaaagct
tcagcaacagtacaaccttttttagttttgcatcttgatattctttctgatgctgtacaa
agtattgaggatgctctcaggttttttgcagcacctgaatctttagaaggctacaaagca
gcatcaagcaaggcttcagaagtggtcagtgcaagcaaggctattaagattcagtcatta
ccatcagtgctgattgttcatttaatgcgatttagttatggagcctctggcagtggcaag
ctgaataaggctataaaatattccaattcccttacaataggacgggaacttctagcaact
tcaaccggttccgctactgagggacggaaatatgagctggtggcaactgtaactcaccat
ggaaataacccatctactggtcattacacagctgattgtagacagcctgacggacgctgg
ttaaggtttgacgatgcagtagtatctgtagttcctatcaaccaggtcctacaggagcat
acatatgttcttttctacaaacgcgtgtcacattga

DBGET integrated database retrieval system