KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_189506Help
Entry
PHYPADRAFT_189506 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PHYPADRAFT_189506
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PHYPADRAFT_189506
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PHYPADRAFT_189506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 981 aa AA seqDB search
MSSPGGVPGGSPRAIPGGISSPRAIRSNTFHGRRPSWPLAEYVHKPTLAMLDHDPGAPSA
LAWRRKLNSHADFLTEFRVTFMEAVRMITLGMRMWFYVKSERAQGRAPPIDPFNRETKPS
ACHGVPCGGMGGGSIGRGFRGDFRRWQLIPGVCEEAPVLADQFSVFVKRDKGNGVVKKDA
SVLYPGRPQELSDTKDDTSVSSWDWNLDGQNSTYHALFPRAWTIYEGEPDPDLKISCRQV
SPFIPHNYEESSFPCCVFSYVVMNTGKQAADVTLLFTWANSIGGNSATTGGHFNEPFETG
AKGGRPVTFAIAAKEMRDVTLTTCPCFSLGGKEVEVTAKDMWTEVKENGSFDKENWNFKP
SAPTRQGSAIGAAIAARVEVPPGEKRDVVFSLAWDSPEVKFLKGKSYHRRYTSFYGTAGD
AASKLTRDALRDYRKWEIAIEDWQQPVLKDEKLPEWYRVTLFNELYYLVAGGTIWTAELE
LAASQETERLQSGETADQMQTETLEHLILKQMQTAMLGSSEAGIATGPSLLQEGEENVGQ
FLYLEGIEYIMWNTYDVHFYASFALLALFPKLELAIQRDVAAATLSQNPEKVKYMADGGV
GIRKVFGAVPHDLGQHDPWVEVNAYNIHDTSHWKDLNPKFVLQVYRDVVATGDRQFAKAV
WPAVYAAMAYMDQFDRDRDGLIENDGFPDQTYDTWSVHGVSAYCGGLWIAALQAAAAMAD
LVDDKDAATYFKGKFNQARDVYERKLWNGEYFNYDSGTSSNSNSVQADQLAGQWYAWASG
LPPLFDDYKARSALQKVFDFNVMKVKGGKWGAANGMHPNGKVDETCMQSREIWTGVTYAA
SAAMIHEGMVEQAFTAAQGVFLAGWSDLGYWFQTPEAWTIDGYFRSLAYMRPLAIWAMQW
ALYPPKSIAEAPRVPSMDRGSALVTHDRFSSLANALRSTSLPQLRKTHDPAGFVLHIILL
GGVVLSTILWLKYGPYKSKHL
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctcctggaggagttcctggaggatctccaagggcaattcctggaggaatttct
tctccaagagcaattcgtagcaatactttccatggccgtcgcccatcatggcctcttgca
gagtatgtgcacaagccaactttggccatgttggatcacgatcctggggccccttctgca
ctagcatggcgacgcaagcttaacagccatgctgatttcctgacagagtttcgagtcacc
tttatggaagctgtgagaatgataactttaggaatgcgtatgtggttttatgtgaagtca
gagcgagctcaaggccgggctcctccaattgatcctttcaatcgcgagacgaagccctct
gcttgtcatggtgtaccgtgcggtggaatggggggtggaagtataggccgtggcttcagg
ggggattttagaagatggcagttaattcctggcgtctgtgaggaagctcccgtgttagcc
gatcaattttcggtttttgttaaacgtgataagggcaatggagttgtgaagaaagatgca
tctgtgctgtaccctggtcgaccacaagaactttcagatacgaaagatgataccagtgta
tcgtcttgggactggaatctagatggccagaactcaacatatcatgctcttttcccccgt
gcgtggacaatatatgaaggtgaaccagacccagacctaaaaatatcgtgccggcaagtt
tctccatttattcctcacaattacgaagaaagtagctttccttgttgtgtgttttcttac
gtggtcatgaatactggcaaacaagctgcagatgtcaccctccttttcacttgggctaat
tctattggtggaaactcagctactactggtggacacttcaatgagccttttgagactggt
gccaaagggggccgtcctgttacatttgccatcgcagcaaaggaaatgcgtgatgtgacc
ttgactacctgtccttgtttctcgctagggggtaaagaggttgaagttactgcaaaagac
atgtggacagaagtgaaagagaacggaagttttgataaagaaaattggaattttaaaccc
tctgcaccgactcgtcaaggttctgcaattggtgctgcgattgctgctcgtgtagaggta
cctccaggtgaaaaacgtgatgtcgttttctcgttagcatgggactctccagaagtcaag
ttcttgaagggcaagtcttaccacagacgctacacgtccttctatggcacagctggagat
gcagcatccaaactgacacgtgacgccctccgtgactatcggaaatgggagatagcaata
gaagattggcagcaaccagtacttaaagatgaaaaactccctgaatggtatcgtgtcaca
ctcttcaacgagttgtattacttagttgctggtggcactatctggaccgctgagttggag
ttagctgccagccaagaaactgagcgattgcaatccggggagactgctgatcaaatgcaa
acagaaacgttggaacacctgatattgaagcaaatgcaaacagcaatgttgggttcctcc
gaggctggaatagccacagggcccagtctacttcaggagggtgaagagaatgttggacag
ttcctttatctagaaggtattgagtacatcatgtggaatacttatgacgttcatttctat
gcgtcatttgcactccttgctctatttccgaagctggaacttgcaatacaacgtgatgtc
gccgcagctactctttctcagaatcctgaaaaagttaaatatatggctgacgggggcgtg
gggataaggaaggtgtttggcgcggttccgcacgatcttgggcaacatgacccttgggtt
gaagttaatgcatacaacatccatgacactagccactggaaagatcttaatccaaagttt
gttcttcaggtttacagagatgtggttgctacaggagatagacaatttgccaaagctgtt
tggccagctgtatatgcagcaatggcgtacatggaccaatttgatcgggaccgggatggt
ctgattgagaacgatggattcccggatcagacatatgatacgtggtctgttcatggtgtt
agtgcatactgtggaggtttgtggatagctgcactgcaagctgcggctgccatggctgat
cttgtagatgataaggatgcagccacttatttcaaaggaaaatttaatcaagctagagat
gtttatgagcgaaagctttggaatggagagtatttcaactatgacagtggaacaagcagt
aacagtaactcagttcaggctgatcaactggcaggccaatggtacgcttgggcatcgggt
ttgccacctcttttcgatgattacaaagctcgcagcgcattacagaaagtatttgacttc
aacgtgatgaaggtcaagggtggtaagtggggagctgcaaacggcatgcatcccaatgga
aaggtggatgaaacttgcatgcaatcacgtgaaatctggactggggtaacatatgcagca
tcagcagctatgatacacgaaggaatggttgagcaggcgttcacagctgctcagggtgtg
tttctagccggctggtctgatctcggatattggtttcaaactccggaagcatggacaatc
gatggctacttcagatcattggcgtacatgcggccgcttgccatctgggcaatgcagtgg
gcattgtacccccccaagtccatagcggaagctcctcgtgtaccatcaatggacaggggc
tccgcacttgtcacccatgatcgattttcctcattagctaatgccctccgcagcacatct
ctaccacagttaagaaagactcatgaccctgctggatttgtcttacatataatcctactg
ggaggtgtagtcctaagcactattctttggctgaagtatggtccttacaagtcaaagcat
ctgtaa

DBGET integrated database retrieval system