KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_189731Help
Entry
PHYPADRAFT_189731 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHYPADRAFT_189731
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PHYPADRAFT_189731
Enzymes [BR:ppp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PHYPADRAFT_189731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 639 aa AA seqDB search
MALYDQNAAAQFVNHEEALFEAQVGEVERWWQSERWRLTKRPYSAREVCKLRGTLPQQYA
SSEQAKKLWRLLKTHQANGTCSRTFGALDPVQVVQMAKYLDTIYVSGWQCASTAATSNEP
GPDLADYPMETVPNKVEHLFMAQQFHDRKQREARLGMTKEQRLRTPYVDMLPPIIADADT
GFGGTTATVKLAKMFVERGAAGIHMEDQASVTKKCGHMGGKVLVATSEHINRLVAARLQF
DIMGVEQILVARTDSGAATLIQSNIDPRDHCFILGATNPAVKDFPLVQAMLDATEAGLSG
AALQAVEDKWLAEANIRLFQDVVADHIRALNLSEGEKSKRVREFLSQVGGLSIVNARRLA
AKMGVAEGVFFDWDLPRTREGYYRFDGGIKACIARGIAFAPYCDLLWMETAKPDLNEARE
FATCVKAKCPELMLAYNLSPSFNWDAAGMTDEQMQSYIPDLARLGFVWQFITLAGFHSNA
LVVDTFARDYAQRGMLAYVQDIQRQERTHGVETLAHQTWSGANYYDQLLKTVTGGVSSTA
AMGHGTWRWDRWMCAGRRGAARRLTGEGGGMMGEVLLWNRCMLGSLSLVWRSLNRVSAGD
GEPALTDYGWDDVVDAGVTETQFKDDSYHSGEVYAKSKL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggctctttacgatcagaatgcagcagctcagtttgtgaaccacgaggaggctctgttc
gaggctcaggtgggcgaggtggagagatggtggcagtccgagagatggcgcctcaccaag
cgcccttactccgcccgtgaggtgtgcaagctgaggggcaccctcccacagcaatacgcc
tccagcgagcaggccaagaagctgtggcgcctcctcaagacccaccaggccaacggcacc
tgctcccgcaccttcggcgccttggaccccgtccaggtcgtgcagatggcaaagtacctg
gacaccatctacgtctccggatggcagtgcgcctccaccgcggccacctcgaacgagccg
ggccctgacctggccgactaccccatggagacggtgcccaacaaggtggagcacctgttc
atggcgcagcagttccacgaccgcaagcaacgcgaggcgcgcctgggcatgaccaaggag
cagaggctgcgcaccccgtacgtggacatgctcccgcccatcatcgccgacgccgacacg
ggattcggtggcaccacggccaccgtgaagctggccaagatgttcgtggagaggggcgcg
gccggaattcacatggaggaccaggcgtccgtgacgaagaagtgcggccacatgggaggc
aaggtgctggtggccacctccgagcacatcaaccgcctggtggcggcgaggctgcagttc
gacatcatgggcgtggagcagattctggtggcccggacggactccggcgcggcgacgctg
atccagtccaacattgacccgcgcgaccactgcttcattttgggcgccaccaacccggcc
gtgaaggacttcccgctggtgcaggccatgctcgacgccacggaggcgggactgtcgggc
gctgcgctgcaggccgtggaggacaagtggctggcggaggccaacatccggctgttccag
gacgtggtggccgaccacatcagggcgctgaacttgtcggagggggagaagtcgaagcgc
gtgcgggagtttttgtcgcaggtgggagggctgtcgattgtgaacgccaggaggctggcg
gccaagatgggcgtggcggagggcgtgttcttcgactgggacctgcccaggacgagggag
gggtactacaggttcgacggcggcatcaaggcctgcattgccagggggatcgcgttcgcg
ccgtactgcgacctgctgtggatggagacggcgaagccggacctgaacgaggcgcgggag
ttcgcgacgtgcgtgaaagccaagtgcccggagctgatgctggcgtacaacctgtcgccg
tcgttcaactgggacgcggccggcatgacggacgagcagatgcagagctacattccggat
ttggcgcggctcgggttcgtttggcagttcatcacgctagcgggattccactcgaacgcg
ctggtggtggacacgttcgcgcgggactacgcgcagcgagggatgctggcgtacgtgcag
gacatccagcgccaggagaggacgcacggcgtggagacgctggctcaccagacgtggagc
ggggccaattactacgaccagctgctgaagacggtgacgggaggagtgtcgtccaccgca
gccatgggtcacggtacgtggcgatgggatcggtggatgtgcgcggggcggcgcggcgct
gcacggcgattgactggggaggggggggggatgatgggagaggttttgttgtggaatcgc
tgcatgttgggttcgttgtcattagtgtggcgtagtttgaaccgagtctcagctggtgac
ggagagcctgcgctgacggattatgggtgggacgatgttgttgatgcaggtgtgacggag
acacagttcaaggacgacagctaccacagtggggaggtgtacgccaagtcgaagttgtag

DBGET integrated database retrieval system