KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_192456Help
Entry
PHYPADRAFT_192456 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PHYPADRAFT_192456
   00051 Fructose and mannose metabolism
    PHYPADRAFT_192456
Enzymes [BR:ppp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PHYPADRAFT_192456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 479 aa AA seqDB search
MKALLFSVVLLVAVLSCSGQRVADITCGVDGSLGSDFQEWEGEFFPNISYIKYEGPASHN
PLAYKYYNAEELIFGKKMKDWLRFSVAFWHTFRGDGGDPFGSPTKRWPWDDGSNSLTVAV
RRMRANFEFLKKLGVEKWCFHDRDIAPEGSTLEESNANLDYIVSVAKKLQEGTNIRPLWG
TAQLFKHPRYMHGAATSPDVRVYAYAAAQVKKAIEVTKLLGGENYVFWGGREGYQTLLNT
DLKKELDHMATFLRSAAEYKKKIGFEGTLLLEPKPQEPTKHQYDWDAATTMGFLKNYGLS
GTNNDYKLNLECNHATLSGHSCHHELETARIYGMLGSVDANTGDAQTGWDTDQFLTDVSE
ATLIMLSVIKNGGLAPGGFNFDAKLRRESVDVEDLFIAHISGMDTIARGLRNAAKLLEEG
RLTKLVEDRYSSFNSPLGKTIEEGKVGFEELEKISLEAEEPPITSGKQELAEMIFYSYV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccttactattttcggttgttctgcttgtagctgtcctaagctgtagcggccag
agggtagcagatatcacgtgtggtgtggacgggagtttgggcagcgattttcaagagtgg
gaaggggaattcttccctaacatttcgtacatcaaatatgaggggcctgcaagtcataat
cctttggcttataaatactataatgctgaggaactgatttttggcaagaagatgaaggat
tggctgcgcttcagtgttgcattctggcatacttttcgtggagatggtggggatcccttt
ggatctcccaccaagagatggccttgggatgacggcagtaattcgctgaccgttgccgta
agaagaatgagagcaaatttcgagtttttgaaaaagcttggagttgagaagtggtgcttt
catgatcgcgatatcgcgcctgaggggtctacacttgaggagtccaacgcaaatcttgat
tacattgtttcagttgcaaaaaagctacaggagggaacaaacattcgaccactttgggga
actgcccagcttttcaagcacccacgttacatgcatggagctgctacaagtccggacgtc
cgtgtttatgcatatgcagctgctcaggtcaagaaggcgatagaggtgacgaaactgcta
ggaggagaaaactacgtcttttggggcgggcgcgaaggttatcagacccttctgaacaca
gatttgaagaaggagcttgatcacatggccactttcttgcgctcagctgcagagtataag
aaaaaaatcggttttgaaggaactttgctattggagccgaagccacaggagccaacaaag
caccagtacgattgggatgcggcaactactatggggtttttgaagaattacggactctca
ggcacgaacaatgactacaagctgaacctagagtgcaatcatgctaccctgtctgggcat
agctgccaccacgagctagaaactgcacgtatatatggaatgttgggtagtgttgatgcc
aacacaggcgatgctcaaactggatgggacactgatcagtttctcaccgatgtcagtgag
gcaactctgatcatgctctctgtgataaagaatggaggactggcacctggagggttcaat
tttgacgcaaaactgaggagggagagtgtggatgtggaagatctcttcattgcccacatc
tcaggcatggataccattgcccgaggacttcgtaatgctgccaaacttttggaggagggt
cggctcacaaagcttgtcgaggatcgatattcaagctttaactccccgcttgggaaaact
attgaggagggaaaagtcgggttcgaggaattggaaaaaatttctcttgaagcagaagag
cctcctattacttctggcaaacaggagttggcggagatgatattttactcttacgtctaa

DBGET integrated database retrieval system