KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_193510Help
Entry
PHYPADRAFT_193510 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1318 aa AA seqDB search
MGGGHLSPPGLSHLASNLPLELIDDLSRRNQVEDAHHLAAAEEDSSCTNESGATFLPNTS
YLCDLRHDAHEATVAVSEPGVVSRWRMKDRMKTGWVALCMCLNIGVDPPDVIKISPCARL
ECWIDPFSTASVKALEAIAKNLQTQYERWQPRARYKVSLDPTVEDVKKLCLSCRKNAKGE
RVLFHYNGHGVPKPTVNGEIWVFNKNFTQYIPLSVYDLELWLGNPSIYVFDCSAAGMIVN
AFCERSEWGSGGASSGSLTSAMKECILLAACGANETLPQNSELPADVFTSCLTTPIKIAL
RWFCPRSLLQLDSDLIDRIPGRQNDRKTPLGELNWIFTAITDTIAWNVLPRELFQRLFRQ
DLLVASLFRNFLLAERIMRAANCCPVSYPRLPPTHQHPMWHAWDMAAEICLSQLPALVDD
PNAEFQPSPFFTEQLTAFEVWLDHGSERKKPPEQLPIVLQVLLSQSHRFRALVLLGRFLD
MGAWAVDLALSVGIFPYVLKLLQTTATDLRQILVFIWTKILALDKSCQVDLVKDGGHSYF
IHFLENPDIHAEQRAMAAYVLAVIVDGHQQGQHACIQAGLIGICLSHIQAAPNALDGQTE
PQLLQWLCLCLGKLWDGVVEGVSIALHDDAPAILGKVLSEPQPEVRAAAVFALGTLLKVR
ADGTSSEGADNDMDEDTSAAEQRIANLLLTVLWDGSPLVRAELAVALARLAFSHNRMFRQ
AAAAYLKPPSHSAVVPYGTGYRNPGYPYSSQFTYAGLQSDSDQGLQTLDGGTPYRSSGNS
PLSDNPVLGESGGNASSNGGSRQWKRSEECNMYVQCIMAAYALARDSFPRVASLGRKVLR
IGGADSAQVMVSSRAGGGVVGYPRNPSVSALPPTPAMAGVLHRSTSWVASSSGTLASTWR
ITTPPPSPPTRPAFLAAGMTTSGLSAVSPDAASIATLLPESTIYKWSCGHFSRPLLEPSH
DDEEEIIARREMREKLALKGIERCQHSSVSKVSDQIGSLDTQSDVGTKAVLLHPFKPLVC
SADENETIRIWDYDANEVINTFENHINPDKGISKLCLLNELDDSLLLVGSSDGSVRVWKD
YTQKDKHRLATSWQAVQGHRPGARGVSAVVDWQQMTGYLYASGQISFIMAWDLDREQLVS
RIPSPSDSYVSALAACQTHHAHVITGSGDGSVKIYDLRSREMLVCAMKPHTTKVVGLDFQ
PGSDFTKIISASQVGDLKFLDLRKSAPYLEVDAHKGNLTSVAVHRYADVIATGSGKQLIK
TFSSSGELLSSVRYHNSFLGQRIGPVSSLHFHSYNVLLAAGASDSMISIYSGESIQGR
NT seq 3957 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaggacacttaagtccacctggtttgtcgcatcttgcttcaaacctccctcta
gagctgatagatgatttgagtaggaggaaccaggtcgaggatgcgcatcaccttgcagca
gcagaagaagacagtagctgcactaatgagtctggggcaacgtttcttcccaacacttcg
tacctttgtgacttgcggcatgatgctcatgaagctactgtggcggtgtctgaacctgga
gttgtttcaagatggcggatgaaggatagaatgaaaacaggatgggtggcgttatgtatg
tgcttaaacattggggtggacccgccagatgtcatcaaaatatcgccatgcgcccgattg
gaatgctggatagatccattctcaactgcatctgtcaaagctttagaagcaatagcaaaa
aacctacaaactcagtacgagcgttggcaacccagggctcgatataaggtcagtttagat
cccaccgttgaagatgtaaaaaagctgtgtctaagttgtcgaaaaaatgcgaagggtgaa
agggttctatttcattacaacggccatggtgtcccaaaaccaacggttaatggagaaatt
tgggtgttcaacaagaattttactcagtacattccactttcggtctacgacttggaattg
tggcttggaaatccatctatatatgtattcgattgctcagcggctggcatgattgtgaat
gcattctgcgagcggtctgagtggggttctggaggtgcttcttctggttccctgacttct
gcaatgaaggaatgcatactattagccgcctgtggagcaaatgaaacacttcctcagaat
agtgagctgccagctgatgtcttcacgtcctgtcttacgactccaatcaaaatcgcttta
agatggttttgtccacgttctttacttcaactagattccgacctaatagacagaatacca
ggtcgtcaaaacgatcggaagactcccttgggggagctgaattggatattcacagctata
acagatacaattgcgtggaatgtgctgccgcgagaactatttcagcgtttgtttcggcaa
gatcttcttgtggctagtttgtttcgtaacttcttattagctgaacgcatcatgagggct
gcaaactgctgcccggtgtcatatcctcggctacctcccacacatcagcaccctatgtgg
catgcatgggatatggctgctgaaatttgtctttcacagttgcctgcattggtggatgat
ccaaatgctgagtttcagcctagtccttttttcacagagcaattgacagcctttgaagtg
tggttggaccatggttctgagcggaagaagccaccagagcagctccctatcgttctgcag
gttttactcagccaatctcacagatttcgtgctctggtgctcttgggccggttcttggat
atgggggcttgggcagtggatttggctttatctgtaggaatatttccatacgttcttaag
ctgctgcaaacaacagctactgatttgcggcagattcttgtgtttatctggacgaagatt
ttagctcttgacaagtcatgtcaagttgatcttgtcaaagatggtggtcactcgtacttc
atccactttctggagaatcctgacattcacgcggaacaaagggccatggctgcatatgta
ctggcagttattgttgacggccaccagcagggccagcacgcttgtatacaagctggccta
atcggcatctgtctctcacatatacaagccgcaccaaatgctctagatggacagactgaa
ccccaacttctgcagtggctctgtctgtgtctggggaagctttgggatggagttgtagag
ggagtatccattgcattgcatgatgatgcaccagcaattcttgggaaggttctttctgag
ccgcagcctgaggttcgtgctgcggccgtgtttgcgctagggactcttcttaaagttcga
gcggacggaacttcttcagaaggagctgacaatgatatggatgaagacacgtcagctgcg
gaacaaagaattgcaaatctcctactaacggtgttgtgggatggaagtccacttgtacga
gccgagcttgctgtagctctagcacggcttgcattcagccacaataggatgtttcgtcag
gctgctgcagcttatttgaaaccgccatcccactcagctgttgtgccttacggaacaggc
tacagaaatccagggtatccttactcttcgcaattcacttatgctggtctacaatcagat
tctgatcaggggcttcaaactctggatggagggacgccctaccgttcttctggaaactct
cctttgtctgacaatccggtacttggagaatctggtggtaatgcttccagcaacgggggc
agcagacaatggaaacgatctgaagaatgcaacatgtatgtgcagtgcataatggctgcg
tatgcattggctagagattcttttcctcgtgtggctagtctgggtcgaaaggttttgagg
ataggtggagctgattctgctcaagttatggtatcgtcgagggctggtggtggtgttgta
ggttatccgcgaaatccatctgtatccgcacttcctcctaccccggctatggctggggta
ttgcataggtctacatcttgggtggcttcttcttcaggtacccttgctagcacgtggcgt
atcacaacacctcctcccagcccacctactcgaccggcatttcttgcagctgggatgact
acttccgggctctcagcggtgagtccggatgcagcttcaatcgccactttgttgccagag
tcaacaatttataagtggagttgtggacatttttctcgaccattgttggaaccctcgcac
gacgatgaagaggagattatagctcggcgggaaatgagagaaaaactggctttgaaaggg
atcgaaagatgtcaacattcaagtgtgagtaaagtgagtgatcagattggcagtttggat
actcaatccgatgtcggaactaaagcagtgcttctgcatccattcaaacccttggtctgt
agtgcagatgagaacgagactatcaggatatgggattatgatgcaaatgaagttattaac
acctttgagaatcatattaaccctgacaaagggatttccaagctttgcttgctgaatgag
ttggatgatagccttctacttgttggttcaagcgatggaagtgtgagggtgtggaaagac
tacacacagaaggataagcatcgcctggcaacatcatggcaggctgtgcaaggacataga
cctggtgcccgaggtgtcagtgctgtggtagattggcaacaaatgacaggttacctgtat
gcatcaggtcaaatttccttcatcatggcttgggatcttgatcgtgagcagctagtctct
aggataccttctccctcagatagctatgtttctgctctggctgcttgtcagacgcatcat
gcacatgtgattacgggatctggagatggctctgtcaagatttatgacctacgatcgcgc
gagatgcttgtgtgtgcaatgaaaccacacaccacgaaagttgttggtctcgacttccaa
cctggatcagatttcactaagataatctcagcatcacaggttggtgatcttaagtttctt
gacttgagaaagagcgcaccttatcttgaagtagatgcgcacaagggaaatctcacctcc
gtagctgttcatcggtacgctgacgtgattgccacaggatcaggcaagcagttgataaaa
accttcagttcaagtggggaactgctgagttctgtccgttaccacaacagcttcttgggc
caaagaatcggcccagttagctcgttgcacttccactcgtataacgtgttgctggctgcg
ggagccagtgactctatgatttccatctattccggggaaagcattcaaggaagatga

DBGET integrated database retrieval system