KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_193642Help
Entry
PHYPADRAFT_193642 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ppp03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 215 aa AA seqDB search
MDDDWDAEDFTPLPPVLAKEATQVKSQWDDEDAEEEPVEEKPKVVAVPKPKAEKKKEKPK
KATSDEGVLSDPLAEKLRQQRLVEEADYQNTSELFGGKTRGGRSLEDFIPKSEDDFLEYA
ELLAQKIRPFEKSFHYMTLLRAIMRHSVANMKASDAKEIASSMTVIANEKLKAERDATAG
KKKTGAKKKQLIVDKPDDDGMGGVSYDAVDDYDFM
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgattgggatgccgaagattttactcccttgccgcctgtgttggccaaggag
gcaactcaagtgaagagccaatgggatgacgaagatgccgaggaggaaccagtagaagag
aagcccaaagttgttgctgtacccaaacccaaggctgagaagaaaaaggagaagccgaag
aaggcaactagcgatgaaggggtcctttccgacccattggcggagaagcttcgacaacaa
aggctggttgaggaagccgattatcaaaatacatctgagctatttggaggcaagactcga
ggtggtcgtagtttagaggattttattcctaagtccgaggatgactttctggagtatgct
gaattgcttgcccagaagataagaccatttgagaaaagttttcattatatgacgcttctt
agagcaatcatgcgtcattcagttgcaaacatgaaagcttctgatgctaaggagattgca
tcaagtatgaccgttattgccaacgagaaattgaaagcggagagggacgccactgcagga
aaaaagaaaacaggtgcgaagaagaagcagcttattgttgataagccagacgatgatgga
atgggtggagtttcttacgatgcagtagatgattacgacttcatgtag

DBGET integrated database retrieval system