KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_199215Help
Entry
PHYPADRAFT_199215 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PHYPADRAFT_199215
   03420 Nucleotide excision repair
    PHYPADRAFT_199215
   03430 Mismatch repair
    PHYPADRAFT_199215
   03440 Homologous recombination
    PHYPADRAFT_199215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 285 aa AA seqDB search
MYQESGGGGDASLFAGGGFMPSQAATGNEFSSSVSGASRRSGGQDGGLQPLTVKMISQAS
QKPGDDAFYVDGLEINNVTLVGMVHDKDERNIDTSFMLDDTTGRIEVKRWIDGQDSYEYF
EMQSVQNFMYVRVHGHLRTFQNKLNVVAFSVRPITDFNEVTFHFLEVIHVHLSRTRKGGV
SAVATPALGNTMATPQNGMYTPVKTPIASSAIPAGGAKEECQRRVHSIYEEPASLQVEQG
LHVDQVVQRMVGFTRAQVREAIDFLVNEGYIYSTIDDDHHKSTNG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaagagagtggaggtggcggagatgcgtccttgtttgctgggggtggcttcatg
ccgtcgcaagctgccactggcaatgagttcagcagctctgtctcaggagctagcaggaga
tcagggggtcaggacggtggactgcagcccttgacagtgaagatgatcagtcaagcttca
cagaagcctggagatgatgctttctacgtcgatggactggagatcaataatgtaacccta
gtgggcatggtgcatgacaaggatgagagaaatatcgatacttctttcatgttggacgac
acaacaggccgcatcgaggtcaaacgctggattgatggccaggactcatatgagtacttt
gaaatgcaaagcgtacaaaattttatgtacgtccgtgttcacggtcatttacggactttt
caaaataagcttaatgtagtagccttctctgtaaggcctattactgattttaatgaagtc
acgtttcactttctcgaggtgatccatgtgcacctttctcgaacacggaaggggggagta
tctgcggttgctacaccggctctagggaacacaatggcaactccacagaatgggatgtat
acgccagtgaagacacccattgcttcctcagcaatacctgctggtggagccaaggaggaa
tgtcagaggagggtccacagcatatatgaagagcctgctagcctacaagttgagcaggga
cttcatgttgatcaagttgttcagaggatggttggctttactcgagctcaagtcagggag
gcgattgattttcttgtcaatgaaggttatatatactccaccatcgatgatgatcaccac
aagtccacaaatgggtaa

DBGET integrated database retrieval system