KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_201011Help
Entry
PHYPADRAFT_201011 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    PHYPADRAFT_201011
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    PHYPADRAFT_201011
Enzymes [BR:ppp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     PHYPADRAFT_201011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 397 aa AA seqDB search
MASAGDVTRTALPRGQPRAEGPACVLGIGTAVPPAEFLQSEYPEFFFNITNCGEKEALKA
KFKRICDKSGIRKRHMFLTEEVLKANPGICTYMEPSLNVRHDIVVVQVPKLAAEAAQKAI
KEWGGRKSDITHIVFATTSGVNMPGADHALAKLLGLKPTVKRVMMYQTGCFGGASVLRVA
KDLAENNKGARVLAVASEVTAVTYRAPSENHLDGLVGSALFGDGAGVYVVGSDPKPEVEK
PLFEVHWAGETILPESDGAIDGHLTEAGLIFHLMKDVPGLISKNIEKFLNEARKPVGSPA
WNEMFWAVHPGGPAILDQVEAKLKLTKDKMQGSRDILSEFGNMSSASVLFVLDQIRHRSV
KMGASTLGEGSEFGFFIGFGPGLTLEVLVLRAAPNSA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgctggggatgttacgaggaccgcgcttcccaggggccagccccgcgctgaa
gggccagcctgcgtgctaggcatcggaactgcggtgcctcccgcggagtttctgcagagt
gagtaccccgaattcttcttcaacatcaccaactgcggcgagaaggaagccctgaaggcc
aaattcaagcgcatctgtgacaagtcgggcatccggaagcgccacatgttcctcacggag
gaggtgctcaaggccaacccaggcatctgcacgtacatggagccctccctgaacgtccgc
catgacatcgtggtcgtccaggtccccaagctcgccgccgaggccgcccagaaggccatc
aaggaatggggcggccgcaagtccgacattacccacatcgtcttcgccaccacctcgggt
gtcaacatgcccggagccgaccacgccctggccaagctgctcggcctgaagcccactgtg
aagcgtgtcatgatgtaccaaaccgggtgtttcggcggtgcatccgtgctcagagtggcc
aaggatctagccgaaaacaacaagggcgcccgagtgctggcagtcgcgagcgaggtgacc
gcagtcacataccgagccccgagcgagaaccacttggacgggcttgtgggctcagctctg
ttcggcgatggcgccggcgtgtacgtggttggatccgaccccaagcctgaggtagagaag
ccattgttcgaagtgcactgggctggagagaccatcttaccagagagtgacggcgccatc
gatggacatctcaccgaagcagggctcatcttccacctcatgaaggatgtacccgggctc
atctccaagaacatcgagaagtttttgaacgaggccaggaagccagtgggatcaccggca
tggaacgagatgttctgggcggtgcatcccggaggtccagccattctcgatcaggtggag
gcgaagctgaagctgaccaaggacaagatgcaagggagcagggacatattgtccgagttt
ggcaacatgtctagcgcctctgtgttgtttgtgttggatcagattcggcacaggtctgtg
aagatgggtgcgtccactttgggcgagggcagcgagttcggattcttcattggcttcgga
ccaggactgacactagaagtgcttgtgctccgcgccgctcccaactccgcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system