KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_201169Help
Entry
PHYPADRAFT_201169 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 670 aa AA seqDB search
MPPAFSIFEVWASVLLVTAVAFFIWRQQGEKKAVETKPVVAKPVQLDEEFEDSSVKRVTV
FFGTQTGTAEGFAKAIAEEAKSRYDSSSVVFKVVDLDDYGADDEQYEARLKKESLALFMV
ATYGDGEPTDNAARFYKWFVESGEDQQIGLDGLKYAVFGLGNRQYEHFNKVAKKVDEALT
QQGAQRIVEVGLGDDDQSIEDDFTAWKEKLWPELDGLLTTEDAPTTPHAPYQAAVAEYRL
VTYEPGTKLYVEEYAAKKNGQAVYDALHPCRADVAFVKELHKPLSDRSCTHLEFGIANTG
LSYETGDHVGVYVENSQEDVEEAAKHLGYPLDTIFSLHVDAEEGQLLSGSLPPPFPGPLL
LETALRRYADLLSPPRKSVLSVLAAFASDPEEAERLKHLASLLGKEEYTKWVVASQRSLI
EVIAAFPSVKLPLGVLFACVAPRLQPRFYSISSSPKFSPTRIHVTCALVYGPSPTGRIHR
GVCSTWMKNARSKDTYGADDCSWAPIFVRQSNFKLPADSTIPIVMVGPGTGLAPFRGFLQ
ERAMLQESGSTLGPAKFFFGCRTRTQDFIYEEELNAFVEKGITELTVAFSREGPRKEYVQ
DKMLEQAGEVWKLIREGGYLYVCGDAKGMARDVHRMLHTIVQQEEGVTSSEAEAVVKKLS
LDGRYQRDVW
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgcccccggctttcagcatttttgaggtatgggcatccgtattgttggtcactgcggtg
gcgttttttatatggaggcagcagggagagaaaaaagctgtcgagacgaagcctgtggtg
gcgaagccggtacagttagatgaggagtttgaggatagctccgtgaagcgagtgacagta
ttcttcgggactcagactggtacagcggaggggtttgcgaaggcgattgctgaagaggcc
aagtcgcggtacgatagctcctccgtggtgtttaaggtcgtggatctagatgattacggc
gcggatgatgagcagtacgaagcaaggttgaagaaggagagcttagcgttgtttatggtg
gcgacctatggtgatggtgagccaactgacaacgctgcgcggttttacaagtggtttgtt
gagagtggggaggatcagcagatagggttggatgggttgaagtacgctgtgtttgggttg
gggaaccgacagtacgagcattttaacaaagtcgcgaagaaggttgatgaggcattgacg
cagcaaggtgcgcaacggatcgtagaagtgggactcggtgacgacgaccagtccatagag
gatgacttcactgcctggaaggaaaagctgtggcccgagctcgatggtttgttgacgact
gaggacgcccccacgactccccatgcgccttatcaggccgctgtcgcagagtatcggctg
gtcacttacgagcctggaaccaagctttacgtggaggagtacgctgccaagaaaaatggg
caagctgtgtacgatgccctccacccctgcagggcagacgtggccttcgtcaaggagcta
cataaacctctctctgacaggtcatgcacccatttggagtttggcattgcaaacacaggc
ctgtcgtatgagaccggcgatcatgttggagtctacgtggagaacagccaggaggatgtt
gaggaggccgctaagcacttgggttaccctcttgatactatcttctccctccatgtggat
gcagaagaggggcagcttttatcagggtctcttccgcccccgttcccagggcctttgctg
cttgagacagcactgcgccgttatgctgatttgctcagtcctcctcgcaaatccgtgctg
tctgtgttggccgcatttgcctccgacccggaagaggccgagcggttgaagcatctggcg
agtctgctcggtaaagaagagtacacgaagtgggtggtggctagccagcggagtctgatc
gaggtgatcgctgcgtttccctcagtgaaattacctctcggtgttctcttcgcttgcgtt
gcgccacgcctgcagccacggttttactccatctcatcttcacccaaattctccccgacc
agaattcacgtcacctgcgcgcttgtatatggtccgagtcccacgggacgcattcaccgt
ggtgtttgctccacctggatgaagaatgcacgctctaaagacacttatggtgcggatgac
tgcagctgggctcccatttttgtccgccagtcgaatttcaaactacccgcagactcgact
atcccaattgtgatggttgggccaggaaccggattggctccattcaggggtttcttgcag
gaaagagctatgctgcaggaatcaggatcaacgctgggaccggctaagttcttctttggt
tgtcgcactcgtacccaggactttatctacgaggaagagctcaacgcctttgttgagaaa
gggatcaccgaactaactgtagccttctcgagggagggtccgagaaaggaatatgtccag
gacaaaatgctggagcaagcaggagaagtgtggaaattgattagagaaggtggatacctg
tatgtctgtggggatgcgaaggggatggctagggatgtacacaggatgttgcacaccatt
gtgcagcaggaagagggcgtgacgagctcggaggcggaggccgttgtgaagaagttgtca
ctggatgggcgttaccagcgtgatgtgtggtaa

DBGET integrated database retrieval system