KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_202996Help
Entry
PHYPADRAFT_202996 CDS       T01041                                 

Gene name
PLC4
Definition
PLC4 phospholiase C protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ppp00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ppp04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 639 aa AA seqDB search
MVSIARLKEACSHCLPPTVAPYHAVCTPPALVTRVFEQATIGRDVRVIGPADLAKFMTDW
QGDRNATEERATSLMADFNFLKSTASRALRIPGLSHSSKYSLSSRHSGSKHGQSAPETPT
FDIATFLKFLLHPEFNGHRVPVSKTPTDDMNAPLSDYYIFSSHNTYLMGNQLCSPSSTAP
IVKALLDGCRVIELDCWNGSNKRIDVLHGGTLTKAVPFEDCVKAIKDNAFTTSAYPVVVT
IESHLDLEHQKEAARVLNKILGNIMFVPPPNELPPQSFRSPEQLKHRIIISDKPPGDALL
SQAANEPEFAQQTLLHEVVRDPSPDNRHEHRHGRRGKKKKLRRRQSQIAESRIQKLPSGK
LGDSGRPAIANDPAFDELLYIHCQKPTEMATEQKKGGPLIKGQHAIMANLSESQLDDLIE
DHTDSLIEFSKTNLTRVYPFGLRVTSSNADPMDAWEHGVQVAAINMQGRDRPVWISKAIF
SRNGGCGYVKKPDILLPESNMDHKSLMNLQPKLELKVTVLLGTDWHKNYDVFKKPDYFVK
VAIHGMHDDEQKFKTHVCKRSREPHWEDEEFVFQIRVPELAILRLEVREYDRIVRDDMVG
QSCVPVTELRQGIRAVQLASKKGEPRSSKLLCHFITRTL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctattgcgcgattgaaagaggcatgttcgcattgcctaccgcccaccgtagcg
ccctaccatgctgtatgtactccgccagcattagttacaagagtttttgagcaggcgacg
ataggaagggatgtacgggtaattggtcccgccgatttggcaaaatttatgacagattgg
cagggcgacagaaatgcgaccgaagagcgcgcgacatccttgatggctgattttaatttc
ttgaagtcgactgcctctcgcgccttgaggattcctgggttaagtcacagctcgaaatat
tcccttagctccaggcacagtggctccaaacacggtcaatcggcgccagagactcctact
tttgacattgctacctttctaaagtttctcctgcatcctgaatttaacggtcaccgagta
cctgtttcgaaaacgccgacagacgacatgaatgcgccactatcagattactatatcttt
tcgagtcacaatacctacttgatgggaaaccagttgtgtagtccatccagcactgccccc
attgtgaaagcactgctggatggatgtcgtgtaatcgagctggattgttggaatggctct
aacaaaagaattgatgtccttcatggcgggaccttgacgaaggcagttccatttgaggac
tgcgttaaggcaataaaagacaatgccttcacgacttcggcttatcctgtcgttgttacc
attgaaagtcacttggatctagagcaccagaaggaagccgccagggtgttaaacaagata
ctcggtaatatcatgtttgtcccccctcccaatgaacttccaccccaatcttttcgatca
cctgagcagttgaagcatcgcattatcatttctgataaacctccgggtgacgcactttta
agtcaggctgcaaatgagcctgaatttgcacagcagacgctattgcatgaagtggtgaga
gaccccagcccagacaacagacatgaacacagacatggacggagggggaagaagaagaag
ctacgcagacgtcaaagccaaatcgctgaaagcaggatacagaaactgccctcaggaaaa
cttggtgactctggcaggccagccatagccaatgatcctgcgtttgatgaattattatac
attcattgtcaaaaacccacagaaatggctaccgagcaaaagaaaggtggcccattgatt
aaaggacaacatgcaataatggctaatctaagcgaatcacaactcgatgaccttattgag
gatcacaccgattctctgatagagttctcgaagaccaatttgactagagtgtacccattt
ggacttcgggttacttcatcaaatgcagaccctatggacgcttgggagcatggagttcaa
gttgcagctataaatatgcaaggacgagatcgacctgtatggatatccaaagcaatattt
agtaggaacggtggttgcggctacgtcaagaagcccgatattcttctacctgaatctaat
atggaccataaaagcctaatgaatttgcaaccaaagcttgagctgaaggtgacggttcta
ttggggaccgactggcacaaaaactatgacgtcttcaagaaaccagactattttgtgaag
gttgccatacatggcatgcatgacgatgagcagaagttcaaaacacatgtgtgcaaacgg
tctcgggaacctcactgggaggatgaagaatttgtatttcaaattcgagtgccggagcta
gcaatactcaggttggaggtgagggagtatgacagaatcgtccgagatgatatggttggc
caatcttgcgtacccgtcactgagctccggcagggaattcgtgctgtgcaactggcatct
aaaaagggagagcctcggagctcgaagctcttgtgccacttcatcacacgtacattatga

DBGET integrated database retrieval system