KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_203522Help
Entry
PHYPADRAFT_203522 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppp00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 688 aa AA seqDB search
MEKLGVVEVDPMLAPHQNHLRYRYREFLKRKMEIEKVEGSLENFAKGYDKFGFTRDGDCI
VYQEWAPAAAAAQLIGDFNNWDGSNHKMERDEFGVWSIRLPDEDGVPAIPHGSKVKFRMQ
KGDGTWVDRIPAWIKYAVVDPNVFAAYYDGVYWDPPAEEKYEFKHARPPKPAAPLIYEAH
VGMSSKEPVVASYRQFADEVLPRIKANNYNTIQLMAIMEHAYYGCFGYHVTNFFAASSRC
GTPEDLKYLIDKAHSMGLRVLMDVVHSHASTNAVDGLAGYDLGQSSQESYFHTGARGYHT
LWDSRLFNYGSWEVQRFLLSNLRWWMDEYKFDGFRFDGVTSMLYHHHGLNMCFTGNYHEY
FSEATDVEAVMYLMLANELVHKLLPDATVIAEDVSGMPTLCRSVEEGGVGFDYRLAMAIP
DKWIQYLKERKDEDWSMGDIVYTLTNRRYTEPCVGYAESHDQSMVGDKTFAFLLMDKEMY
FSMTATQPANLIVDRGIALHKMIHFITMALGGEGYLNFMGNEFGHPEWIDFPRQGNNWSF
DKCRRRWDLVDQDHLRYKFMNNFNRAMIALEEEFQFVSSRKQYISCQHEYDKLIVFERGD
LVFVFNFHPTNTYSGLKVGCEIPGKYRICLDSDAAEFGGHSRVDHNVDHFTSPEGEPGRP
ETNYNNRPHSFMVMAPSRSCQVYYKVPE
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggagaagttgggtgtagtggaagtggaccctatgctcgcccctcatcaaaatcatctc
cgataccgttatcgtgaattcttgaaacgaaagatggaaattgagaaggttgaggggagt
ttggagaattttgccaaaggttatgataagtttggatttactcgtgatggggactgcatc
gtgtaccaagaatgggctcctgcagcagcggctgctcaattgattggtgacttcaacaac
tgggatggaagtaatcacaagatggaaagggacgagtttggtgtctggtctatcaggttg
cctgatgaggatggtgttcctgccatccctcatggttccaaagttaagttcagaatgcag
aaaggcgatggtacttgggtggatcgtattccagcttggattaaatatgccgtggttgac
cctaatgtgtttgctgcatattatgatggtgtttactgggatccacctgcggaagaaaaa
tatgagttcaagcatgctcgtccaccaaaaccggcagctccactcatctacgaagctcat
gtagggatgagctcgaaagagcctgttgtagcgtcctacaggcagtttgcagacgaagtt
cttcctagaattaaagcgaataattacaacactatacagctaatggcaattatggagcat
gcttactatggttgctttgggtatcatgtcacaaatttctttgccgccagtagccgttgt
ggtactcccgaagacctgaagtatctgattgacaaggcacactccatggggcttcgggtt
ttgatggatgtggtccacagtcacgctagcacaaatgctgtcgacgggttggctgggtat
gatctgggtcagtcttctcaggaatcgtatttccacactggtgctcgaggatatcatacg
ctctgggatagtcgtctattcaactatggttcttgggaagtgcagcggtttcttctgtcg
aatctgcggtggtggatggatgagtataagttcgatggcttccgctttgatggagtcact
tctatgctttaccatcaccacgggctgaacatgtgcttcactggaaactaccacgagtat
ttcagtgaggccactgatgtcgaagcagtgatgtatttaatgctcgcaaatgagcttgtc
cacaagttattacccgatgctacagtgattgcagaagatgtatctggcatgcctaccctc
tgccgatccgtcgaagaaggaggggttggctttgactatcgtctcgctatggctataccg
gacaaatggattcaatatctgaaagagaggaaggatgaagactggtccatgggtgatatt
gtttatactctaaccaaccggagatacacagagccatgtgttggatatgccgagagccat
gatcagtcaatggttggagacaagacatttgcatttctgttgatggacaaggaaatgtat
tttagcatgacagctacgcaaccagcaaatctaattgtcgaccgtgggattgcattgcat
aagatgattcactttattaccatggctctgggtggagaaggttacttgaattttatgggc
aatgagtttggtcatccagagtggatcgactttcctagacaaggcaataattggtcattt
gacaagtgccgaaggcggtgggaccttgtggaccaggaccatcttcgatataagttcatg
aataatttcaatagagcaatgatagcgcttgaagaagaatttcagttcgtgagttctcga
aagcagtatatctcctgtcaacatgaatatgacaagctaattgtttttgaaagaggagac
ctggtcttcgtctttaacttccatccgacaaacacgtattctgggttgaaggttggctgt
gagattcctggcaaatatcgaatttgcctggatagtgatgcggctgagtttggaggtcat
agtcgggtggatcataatgttgatcacttcactagtcccgagggtgagccaggaaggcca
gagactaactacaacaaccgaccgcactcctttatggtcatggctccaagtcgaagctgt
caggtatactacaaagtaccggagtga

DBGET integrated database retrieval system