KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_204665Help
Entry
PHYPADRAFT_204665 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K20496  
laurate 7-monooxygenase [EC:1.14.13.206]
Organism
ppp  Physcomitrella patens subsp. patens
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 479 aa AA seqDB search
MNLPPGPKAMPLLGNLLQMGSHPHRTMTAMHKKYGHILYIRLGCIPTVVVDSPQLIAEIT
KEQDNVFSSRPHMTFTDIVAYDAHDFAMAPYGPHWRYVRRICVHELLTPKRLEITMKERI
EESRCMIMAVAEAAQKGEIVDMRDVFAGVSMTVMCRMLLGRREFAATGKKAKDFKHLIHE
LFRLMGALNLRDFVPALGWLDLQGFERDMYKLRDEFDEVFDAVIQEHRDLASGKLPGGKP
NDFISVLLDLPGENGAPHLDDKTIKAITLDMMAGATDTSAVTNEWAMAEIIRNTEIQRKL
QEEIDSVVGLERNVQESDINKLPYLMCVVKETFRLHPAGPFAIPRETMADTKLSGYRIPK
GTRVLINIFSLGRSSETWKDPLKFQPERWANENLSAIHDMGFRILPFGYGRRQCPGYNLG
TTMVLLTLARLLHGFKWSFPPGVTAENIDMEELYGCTTPLRTRLRTIATPRLAPHLYSQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcccgcctggtcctaaggcgatgccacttctgggcaacctcttgcagatgggt
tcgcacccgcaccggaccatgacagccatgcacaaaaaatatggccatattttgtacatt
cgcttgggttgcatcccgacagtggtcgtggacagcccgcagctaatcgctgaaatcaca
aaggagcaagacaatgtgttctcgtcgagacctcatatgaccttcaccgacattgtggcc
tacgacgctcacgacttcgctatggcaccttatggcccccactggcgctacgtgcggcgc
atctgtgtgcatgagctcttgactcccaagcgtcttgagatcaccatgaaagaacggatt
gaggagtcgaggtgtatgatcatggctgtggcggaagcagctcagaagggtgagattgtg
gacatgagggatgtgttcgcaggggtgtcgatgacggtgatgtgtcgcatgttgctcggg
aggcgggagtttgctgcaacgggtaagaaggcgaaagatttcaagcatctcattcatgaa
ctgtttcggctcatgggagccctgaacctcagggattttgtgcctgcgctcgggtggcta
gacttgcagggattcgagagagacatgtacaagctgcgggacgaattcgacgaggttttc
gatgctgtcattcaagagcaccgagacttggcgtccgggaaacttcccggaggaaagccg
aatgacttcatcagcgtgctgctcgacctcccaggcgagaacggggcaccacacctggac
gacaagactatcaaggctatcacccttgacatgatggcaggagcaacagatacctcagcg
gtgacaaatgaatgggctatggcggaaatcataagaaataccgagattcaacgtaagctt
caagaggagatagactccgtggtagggcttgagcgtaacgtacaggaatctgacatcaac
aagctcccatacctcatgtgcgtcgtgaaagagactttccgtcttcaccctgccggtccc
ttcgcaatcccacgggaaaccatggcggacaccaagcttagtgggtaccgaattcccaag
ggaacccgggtgcttattaacatattctcacttggacgaagctccgagacgtggaaggat
cccctcaaattccagccggagaggtgggcaaacgaaaacctctcggcgattcacgacatg
ggattccggatccttcccttcggctatggcaggaggcaatgtccggggtacaacctgggc
accaccatggtactcttgactttagcccgcctcctccacggattcaaatggtccttccca
cccggcgtcacggcggaaaacattgacatggaggagctctatgggtgtaccacacccctg
agaacccggctgcgcaccattgctaccccaagactcgcccctcatttatattcccagtga

DBGET integrated database retrieval system