KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_204665Help
Entry
PHYPADRAFT_204665 CDS       T01041                                 

Definition
(RefSeq) hypothetical protein
  KO
K20496  
laurate 7-monooxygenase [EC:1.14.13.206]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.206  laurate 7-monooxygenase
     PHYPADRAFT_204665
Cytochrome P450 [BR:ppp00199]
 Cytochrome P450, plant type
  CYP703 family
   PHYPADRAFT_204665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 479 aa AA seqDB search
MNLPPGPKAMPLLGNLLQMGSHPHRTMTAMHKKYGHILYIRLGCIPTVVVDSPQLIAEIT
KEQDNVFSSRPHMTFTDIVAYDAHDFAMAPYGPHWRYVRRICVHELLTPKRLEITMKERI
EESRCMIMAVAEAAQKGEIVDMRDVFAGVSMTVMCRMLLGRREFAATGKKAKDFKHLIHE
LFRLMGALNLRDFVPALGWLDLQGFERDMYKLRDEFDEVFDAVIQEHRDLASGKLPGGKP
NDFISVLLDLPGENGAPHLDDKTIKAITLDMMAGATDTSAVTNEWAMAEIIRNTEIQRKL
QEEIDSVVGLERNVQESDINKLPYLMCVVKETFRLHPAGPFAIPRETMADTKLSGYRIPK
GTRVLINIFSLGRSSETWKDPLKFQPERWANENLSAIHDMGFRILPFGYGRRQCPGYNLG
TTMVLLTLARLLHGFKWSFPPGVTAENIDMEELYGCTTPLRTRLRTIATPRLAPHLYSQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcccgcctggtcctaaggcgatgccacttctgggcaacctcttgcagatgggt
tcgcacccgcaccggaccatgacagccatgcacaaaaaatatggccatattttgtacatt
cgcttgggttgcatcccgacagtggtcgtggacagcccgcagctaatcgctgaaatcaca
aaggagcaagacaatgtgttctcgtcgagacctcatatgaccttcaccgacattgtggcc
tacgacgctcacgacttcgctatggcaccttatggcccccactggcgctacgtgcggcgc
atctgtgtgcatgagctcttgactcccaagcgtcttgagatcaccatgaaagaacggatt
gaggagtcgaggtgtatgatcatggctgtggcggaagcagctcagaagggtgagattgtg
gacatgagggatgtgttcgcaggggtgtcgatgacggtgatgtgtcgcatgttgctcggg
aggcgggagtttgctgcaacgggtaagaaggcgaaagatttcaagcatctcattcatgaa
ctgtttcggctcatgggagccctgaacctcagggattttgtgcctgcgctcgggtggcta
gacttgcagggattcgagagagacatgtacaagctgcgggacgaattcgacgaggttttc
gatgctgtcattcaagagcaccgagacttggcgtccgggaaacttcccggaggaaagccg
aatgacttcatcagcgtgctgctcgacctcccaggcgagaacggggcaccacacctggac
gacaagactatcaaggctatcacccttgacatgatggcaggagcaacagatacctcagcg
gtgacaaatgaatgggctatggcggaaatcataagaaataccgagattcaacgtaagctt
caagaggagatagactccgtggtagggcttgagcgtaacgtacaggaatctgacatcaac
aagctcccatacctcatgtgcgtcgtgaaagagactttccgtcttcaccctgccggtccc
ttcgcaatcccacgggaaaccatggcggacaccaagcttagtgggtaccgaattcccaag
ggaacccgggtgcttattaacatattctcacttggacgaagctccgagacgtggaaggat
cccctcaaattccagccggagaggtgggcaaacgaaaacctctcggcgattcacgacatg
ggattccggatccttcccttcggctatggcaggaggcaatgtccggggtacaacctgggc
accaccatggtactcttgactttagcccgcctcctccacggattcaaatggtccttccca
cccggcgtcacggcggaaaacattgacatggaggagctctatgggtgtaccacacccctg
agaacccggctgcgcaccattgctaccccaagactcgcccctcatttatattcccagtga

DBGET integrated database retrieval system