KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_205387Help
Entry
PHYPADRAFT_205387 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Exosome [BR:ppp04147]
 Exosomal proteins
  Proteins found in most exosomes
   PHYPADRAFT_205387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 132 aa AA seqDB search
MSWQSYVDDHLMYPLPTGHSLVAAAIIGHDGSVWAQSEMFPQLSSTEVEKLLDGFEDGSL
LAENGLFLGSAKYMVLQGEAGVVIRGKKGAGGCTVKKTNSAFVIGLYDYPVTPGECNMVV
ERLGDYLCDQGL
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagtcgtacgtcgatgaccacttgatgtacccgcttccgacggggcatagt
ctggtggccgccgccatcatcgggcacgatggaagtgtttgggcgcagagcgagatgttt
ccgcagttgagctcaacggaggtggaaaagcttctggatggtttcgaggacgggagcttg
ctggccgagaacgggctgtttttgggaagcgccaagtacatggttctgcagggtgaagct
ggcgttgtgatccgggggaagaagggtgcaggagggtgcacagtgaagaagacgaacagc
gcgtttgtgatcgggctgtacgactatccagtgacgccgggcgaatgcaacatggtggtg
gagaggctgggggattatctgtgcgatcaggggctttga

DBGET integrated database retrieval system