KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_207886Help
Entry
PHYPADRAFT_207886 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PHYPADRAFT_207886
Peptidases [BR:ppp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PHYPADRAFT_207886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 492 aa AA seqDB search
MPTVSVKWQKEVFSAVEIDLDQPGYVFKCQLYDLTGVHPERQKIMVKGGLLKDDADLHKL
GLKEGQRLMLIGTADAIPQAPAEVPVFAEDLPEKEQGAAVLGHTAGLVNLGNTCYMNSTV
QCLHSVPELRDALRGYSAAGANILDPLSHTLTVATRDLFNELDNSARPVAPYRFLTVLRD
KYPQFGQQTNQGVYMQQDAEECWTQLIYVLSQGLKSSSINKQLSAPLVQELFGVELQNTL
KCAESSEASSENETVFSLKCHISQEVNHLHDGLKHGLKGELEKTSPLLGRSALFIKESHI
QKLPQYLTIQFVRFFWKRESNQKAKILRKVGYPLVLDVLDFCTEELKEKLVEPRRRQFAA
EEVKAGLKKDEKGKVGAEGVKSLETSTLSERKEHDMDTDGSATSSTTKSDGSGAATEVSG
IYDLVAVLTHKGRSADSGHYVSWVKQDNGKWIEFDDDQPTVQREESITNLSGGGDWHMAY
ICLYKARAVPPA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgccgacggtgagcgtgaaatggcagaaggaggtcttctccgccgtggagattgacctc
gatcagccaggatatgtgttcaagtgtcaactgtatgatcttaccggcgtgcatccggag
aggcagaagattatggttaaaggcggtttgctgaaggatgatgcggacttgcataagctg
gggttgaaggaaggccagcggctgatgctcataggcaccgctgatgcgatcccgcaagcg
cctgctgaggtccccgtttttgccgaagatctgccggagaaggagcagggtgcggctgtg
cttggccatacggccgggcttgtcaatttggggaatacttgttacatgaactccacggtg
cagtgcttacactcagtgccagagctcagagacgcgttgcgaggctactctgccgcgggc
gccaacattttggatcccctgtcgcacaccctaaccgtggctacacgcgatttgtttaat
gagctggataatagcgcccgacctgtggcgccatatcggttcctcactgtgctacgagac
aagtatcctcaattcggccaacagacaaatcaaggcgtctacatgcaacaagacgcggag
gaatgctggacacagctaatatacgttttgtcacaggggttgaaaagctcgtcaattaac
aagcagttatcagcacctctagtgcaggagttgtttggtgttgagttacaaaatacattg
aagtgtgcagaaagttctgaggcaagttcggagaatgaaacggtgttcagtttgaagtgc
cacatctcacaagaagtcaatcatttgcatgatggtttgaagcatggtttgaaaggggag
cttgagaagacttcaccactgcttggacggagtgctctgtttatcaaagagtctcatatt
cagaagcttcctcaatatctaacaatacagtttgtgcggtttttctggaaaagagaatct
aatcagaaagccaagatcctgcggaaggtgggttatccactggttttagatgtattagat
ttctgcacagaggagcttaaagagaaactggttgaaccccgtagaaggcaatttgcagct
gaggaagttaaagctggtctgaagaaggatgaaaaggggaaagtgggtgcagaaggggtg
aagtcgctcgagacatcaaccttgagcgaacgaaaagaacatgatatggatactgatggt
tcagcaacttcttcaaccacaaaatcggatggaagtggagctgccacggaagtctctgga
atatatgatctcgttgcagtgctgacacataaagggcgtagcgctgattcaggtcattat
gtttcctgggttaagcaagataatggaaaatggatagagtttgatgacgatcaaccaact
gtccagagggaggagagtattacaaatttatcagggggaggtgattggcatatggcgtac
atctgtttgtacaaagcacgggcagtcccgcccgcgtaa

DBGET integrated database retrieval system