KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_209243Help
Entry
PHYPADRAFT_209243 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppp00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ppp00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:ppp00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:ppp00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ppp00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 652 aa AA seqDB search
MGAVLLLCLWISVGAQSSSKHSFVIENNLFLKDGVPFRIIGGDLHYFRVHPLLWEDRLLR
AKALGLNAIQTYVPWNLHEPRPGLLNFNGSADLLSFLKLAQELDFLVILRIGPYICAEWD
LGGLPAWLLELKPSVRLRSSDASYLSQVDNWWKELLPKIAPELFSAGGSVIMVQIENEYG
SFGIDKLYLQFLQKQVRSHLGNDIIIYTTDGAVEENLSYGSLSDDGVFAAIDFPTGWDPA
AAFALQKRFNSPGMSPPFSAEFYTGWLTHWGERLAQTDAKSTAVALDDILRLNASVVLYM
VHGGTNFGFWSGANTGAGPSDFQPDITSYDYDAPIGEAGDVTGNKYQEIRKVLSKYVGRE
LPDPPPLPQRTAYGEVTMTKMGSLFDVLDVIGNPPGGVKLEWPVPMEHLRQASGFILYRA
CLPSSVRPGSKISVVEVYDRAQVFVVSASKNRMFLGTLERWSSNSIMLPTAAAVADFRLD
ILVENMGRVNYGRYMGENKGISEAVFLDDDPILGWTIHTIGLESVSELGPASFTTTGIAN
SNLEITKIKPTIELLSDSDPLSGPFFYEGTLNVTQPSDTFMSFNGWNKGVAFVNGFNLGR
FWPSAGPQCTLYVPSPLLRRGENKLIILELEDSRPVQTVEFKDRVDFTCGSY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgggagcagtgcttctgctctgtttgtggatttccgtcggggctcaatcttcctcaaag
cacagttttgtcattgaaaataatcttttcttaaaagatggggtcccgtttcgaatcatt
gggggtgacctgcactacttccgtgtacatccactgctctgggaagacagactactcaga
gcgaaagcacttggcttgaatgcaattcaaacctatgtcccttggaaccttcatgaacca
cgccctggccttctcaacttcaatggctctgcagatctattgtcgttcttgaagctggct
caagaactagattttctggtgattctccgcattgggccttacatctgtgcagagtgggac
ctcggtggtcttcccgcctggctccttgaattgaaaccttcggtgagattgcggtcatct
gatgcatcttatctttctcaggttgacaattggtggaaggaactgcttcctaagatagcc
cccgagttattctcagcaggcggttcggttatcatggttcagattgaaaacgaatatgga
tcttttgggatcgacaaattgtacctacagttcctccaaaagcaagttaggtcacatctg
ggaaatgatataatcatatacacgactgacggtgcggtcgaggagaacctaagctatggc
tccctatcagacgacggtgtgtttgcagcaatagacttcccaacaggctgggatccagct
gcggcttttgctctgcagaagcgtttcaactccccaggaatgtcaccaccattttctgcg
gagttctacacaggctggctgactcattggggagagagactggctcaaacggatgcaaaa
agtactgcagttgctcttgatgatattttacgactcaatgcttctgttgtactttatatg
gttcatggaggaacaaattttgggttttggagtggagccaacacaggggctggaccctcc
gactttcaaccagatattacttcgtacgattatgatgccccaattggagaggctggagat
gtaactggtaataagtatcaagaaataaggaaagtgctaagtaagtacgtaggtcgagaa
ctgcccgatccccctccgcttcctcagcgaactgcatatggggaagtaacaatgacaaaa
atggggtctctttttgatgttttggatgtcattggtaatcctcctggcggtgtcaagttg
gaatggcccgtcccaatggaacatctcagacaagcctcggggtttattttatatcgggcg
tgtcttccttccagtgtacgaccaggaagcaaaatttctgtagtggaggtatatgacaga
gcacaggtatttgttgtaagcgcttccaagaataggatgtttctgggcacactagaacgc
tggtccagcaactcaataatgttgcctactgcagccgctgtagctgattttcggcttgat
atcctggttgagaatatggggcgtgttaactatggacggtatatgggtgaaaacaagggt
atttcagaggctgtattccttgatgatgatcccattcttggttggactatacatacgatt
ggattagaaagtgtttcagagcttgggcccgcttccttcacaacaactggcattgctaac
agtaatttggagataaccaaaatcaagccaaccatcgaactcctctcggattcggatcct
ttaagcggtccttttttctacgaaggtacccttaatgtaacacagcctagtgatacattc
atgagctttaatggctggaacaagggagtggcctttgtcaatggattcaatctcggaaga
ttttggcctagtgcgggcccacagtgtacattgtacgtccccagtcctcttcttcgacgt
ggagaaaataaattgatcattttggaacttgaggattcccgaccagtacagactgtggag
ttcaaggacagagtcgactttacttgtgggagttactag

DBGET integrated database retrieval system