KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_209243Help
Entry
PHYPADRAFT_209243 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PHYPADRAFT_209243
  Lipid metabolism
   00600 Sphingolipid metabolism
    PHYPADRAFT_209243
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    PHYPADRAFT_209243
   00604 Glycosphingolipid biosynthesis - ganglio series
    PHYPADRAFT_209243
   00511 Other glycan degradation
    PHYPADRAFT_209243
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PHYPADRAFT_209243
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PHYPADRAFT_209243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 652 aa AA seqDB search
MGAVLLLCLWISVGAQSSSKHSFVIENNLFLKDGVPFRIIGGDLHYFRVHPLLWEDRLLR
AKALGLNAIQTYVPWNLHEPRPGLLNFNGSADLLSFLKLAQELDFLVILRIGPYICAEWD
LGGLPAWLLELKPSVRLRSSDASYLSQVDNWWKELLPKIAPELFSAGGSVIMVQIENEYG
SFGIDKLYLQFLQKQVRSHLGNDIIIYTTDGAVEENLSYGSLSDDGVFAAIDFPTGWDPA
AAFALQKRFNSPGMSPPFSAEFYTGWLTHWGERLAQTDAKSTAVALDDILRLNASVVLYM
VHGGTNFGFWSGANTGAGPSDFQPDITSYDYDAPIGEAGDVTGNKYQEIRKVLSKYVGRE
LPDPPPLPQRTAYGEVTMTKMGSLFDVLDVIGNPPGGVKLEWPVPMEHLRQASGFILYRA
CLPSSVRPGSKISVVEVYDRAQVFVVSASKNRMFLGTLERWSSNSIMLPTAAAVADFRLD
ILVENMGRVNYGRYMGENKGISEAVFLDDDPILGWTIHTIGLESVSELGPASFTTTGIAN
SNLEITKIKPTIELLSDSDPLSGPFFYEGTLNVTQPSDTFMSFNGWNKGVAFVNGFNLGR
FWPSAGPQCTLYVPSPLLRRGENKLIILELEDSRPVQTVEFKDRVDFTCGSY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgggagcagtgcttctgctctgtttgtggatttccgtcggggctcaatcttcctcaaag
cacagttttgtcattgaaaataatcttttcttaaaagatggggtcccgtttcgaatcatt
gggggtgacctgcactacttccgtgtacatccactgctctgggaagacagactactcaga
gcgaaagcacttggcttgaatgcaattcaaacctatgtcccttggaaccttcatgaacca
cgccctggccttctcaacttcaatggctctgcagatctattgtcgttcttgaagctggct
caagaactagattttctggtgattctccgcattgggccttacatctgtgcagagtgggac
ctcggtggtcttcccgcctggctccttgaattgaaaccttcggtgagattgcggtcatct
gatgcatcttatctttctcaggttgacaattggtggaaggaactgcttcctaagatagcc
cccgagttattctcagcaggcggttcggttatcatggttcagattgaaaacgaatatgga
tcttttgggatcgacaaattgtacctacagttcctccaaaagcaagttaggtcacatctg
ggaaatgatataatcatatacacgactgacggtgcggtcgaggagaacctaagctatggc
tccctatcagacgacggtgtgtttgcagcaatagacttcccaacaggctgggatccagct
gcggcttttgctctgcagaagcgtttcaactccccaggaatgtcaccaccattttctgcg
gagttctacacaggctggctgactcattggggagagagactggctcaaacggatgcaaaa
agtactgcagttgctcttgatgatattttacgactcaatgcttctgttgtactttatatg
gttcatggaggaacaaattttgggttttggagtggagccaacacaggggctggaccctcc
gactttcaaccagatattacttcgtacgattatgatgccccaattggagaggctggagat
gtaactggtaataagtatcaagaaataaggaaagtgctaagtaagtacgtaggtcgagaa
ctgcccgatccccctccgcttcctcagcgaactgcatatggggaagtaacaatgacaaaa
atggggtctctttttgatgttttggatgtcattggtaatcctcctggcggtgtcaagttg
gaatggcccgtcccaatggaacatctcagacaagcctcggggtttattttatatcgggcg
tgtcttccttccagtgtacgaccaggaagcaaaatttctgtagtggaggtatatgacaga
gcacaggtatttgttgtaagcgcttccaagaataggatgtttctgggcacactagaacgc
tggtccagcaactcaataatgttgcctactgcagccgctgtagctgattttcggcttgat
atcctggttgagaatatggggcgtgttaactatggacggtatatgggtgaaaacaagggt
atttcagaggctgtattccttgatgatgatcccattcttggttggactatacatacgatt
ggattagaaagtgtttcagagcttgggcccgcttccttcacaacaactggcattgctaac
agtaatttggagataaccaaaatcaagccaaccatcgaactcctctcggattcggatcct
ttaagcggtccttttttctacgaaggtacccttaatgtaacacagcctagtgatacattc
atgagctttaatggctggaacaagggagtggcctttgtcaatggattcaatctcggaaga
ttttggcctagtgcgggcccacagtgtacattgtacgtccccagtcctcttcttcgacgt
ggagaaaataaattgatcattttggaacttgaggattcccgaccagtacagactgtggag
ttcaaggacagagtcgactttacttgtgggagttactag

DBGET integrated database retrieval system