KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_216093Help
Entry
PHYPADRAFT_216093 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
ppp  Physcomitrella patens subsp. patens
Brite
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PHYPADRAFT_216093
Peptidases [BR:ppp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PHYPADRAFT_216093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1123 aa AA seqDB search
MTVIAAPPEEDDDMLVPPQDFNDVIEPMEVVGQGEGVATVENQHVDDPQTGKFTWNIENF
SKLSLRKHYSETFTVGGYKWRVLLFPKGNNVDHLSVYLDVADSAQLPYGWSRFAHFTLAV
VNPYDPKLTVKKDTQHHFNVRESDWGFTSFMPLPDLYDPSRGFLMNDTLIVEADVNVRKV
VDYWAYDSKKETGYVGLKNQGATCYMNSLLQTLYHLPYFRKAVYHMPTTENDVPSNSIPL
ALQSLFYKIQYSDTSIATKDLTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGTAVEG
TIQQLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCKDVYESFDKYVEVERLEGENK
YHAEQFGLQDAKKGVLFIDFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPLQLDLDRENG
KYLSPDADRSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWFKFDDERVTKEEPKRA
LEEQYGGEEELPQTNPGFNNTPFKFTKYSNAYMLVYIREADKDKIVCNVDEKDIAEHLQV
RLKKEQEEKERKRKEKAEAHLYTIIKASLHLIFLHLVGRDEDLQNQIGKDIHFDLVDHEK
VRSFRIQKQTLFTQFKASKELGVPVECQRFWLWAKRQNHTYRPNRPLTEQEEAQTVGHLK
EASNKAHNAELKLFLEVQRTPGAESVPMPPPIKTKEDVLLFFKLYDPLKEELRYVGRSYV
KASGRPADILERLNEMAGFPPNEEIQLYEEIKFEPNVMCEHIEKKSTFKASQLEDGDIIC
YQRALTREQELASRYPDVPSFLEYVRNRQIVHFRRLDKPKDDEFCLELSKQHTYDDVVEK
VAEEIKLEDASKIRLTSHNCYSQQPKPQPIKYRGVERLSDMLVHYNQTSDILYFETLDLP
LPELQGLKTLKVAFHNAKTEEVSVHNIRLPKQSTVGDVVNELKGKVELSSPKAELRILEV
FYHKIYKIFPLSEKIENINDQYWTLRAEEVPDEEKELGPQDRLIHVYHFTRDASQNYMVQ
NFGEPFFLVVRENETLTEVKQRIQKKLVISDEEFSKWKFAFLSLGRPEYLQDGDVVAARF
QKRDTYGAWEHYLGLEHADCAPKRSHTTNQNRHNFEKPVKIYN
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcatcgctgcacccccggaagaggatgatgatatgctggtgcctccccaggac
ttcaacgacgttattgaaccgatggaagtggtagggcaaggagaaggtgttgctactgtg
gagaatcagcatgtggatgaccctcaaacggggaaatttacatggaatatcgagaatttc
tcgaaattatctctgagaaagcattattccgaaacgtttactgttggtggttacaaatgg
cgggtgctgttatttccgaaaggcaataatgtggatcatctctcagtatacttggatgtt
gctgattccgcgcagctaccctatggctggagtagatttgcacattttactctggccgtt
gtgaatccgtatgacccaaagttgactgtcaagaaagatacacagcatcattttaatgta
cgcgaaagtgattggggattcacatcgttcatgcctttaccagacttgtacgatccatct
cgaggtttcttgatgaatgatactcttatcgtagaagctgatgtgaatgttcgtaaggtg
gtcgattactgggcgtatgattcgaagaaagagacaggttatgttggattgaagaatcaa
ggagcgacatgctacatgaattctctcctccagacgttgtatcacctgccctactttcgg
aaggctgtttatcatatgccaacgactgaaaacgatgttccatctaacagcatccctcta
gccctacagagcttattttataaaattcagtacagtgatactagtattgctacaaaggat
ctcactaaatcttttgggtgggacacctacgactcttttatgcaacatgatgttcaagag
ctgaatcgggttctttgcgagaagctggaagacaaaatgaagggaactgctgtcgagggc
acaatccagcaactgttcgaagggcatcacatgaactacatagagtgcatcaatgttgat
tataaatcaacacggaaagagtctttctatgatttgcagctggatgtgaaaggatgcaag
gatgtatatgaatcttttgacaagtatgttgaagtagaacggttggagggcgagaacaaa
taccacgccgaacaatttgggttgcaggatgcgaaaaaaggagtcctatttatagacttc
ccccctgttcttcagctacagttaaagcgttttgagtatgactttatgcgagacacaatg
gtgaagattaatgatcgctatgagtttccactgcaactagacttggatagggagaacgga
aagtacctctctcctgatgccgaccgtagtgttcgaaatttgtacaccttgcacagtgta
ctggttcacagtggtggagtacatggtggtcattactacgcttttatcagacccacactc
tctgaccagtggtttaagtttgatgatgagcgagtgacaaaggaggagcctaagagagct
cttgaggagcagtatggaggagaggaggaacttccacaaacaaatccaggttttaataac
actcccttcaagttcacaaaatactcaaacgcatacatgttggtgtatatcagagaggcc
gacaaggacaagattgtttgcaatgtggatgagaaggatattgcagaacatttgcaggtg
aggttgaagaaagagcaagaggagaaagaaaggaagaggaaggagaaggctgaagctcat
ctttacactatcattaaggcaagtttgcatctaatttttttgcatttagttggacgggat
gaagacctacagaaccagattggaaaggacatccatttcgatttggtagatcatgaaaaa
gttcgcagcttccgcatccaaaagcaaaccctctttacgcagttcaaggcatcgaaggag
cttggcgtccctgttgagtgtcaacggttttggctttgggcgaagcgccaaaaccacaca
tatcgtcctaatagaccacttactgagcaagaagaggctcaaacggttgggcacttaaaa
gaggcctccaacaaggctcacaatgctgagttgaaacttttcttggaggtgcagcgcacc
cctggtgcagaatcagttccaatgcctcctccaattaagacgaaggaggatgtgcttttg
tttttcaaactgtacgatcctttgaaggaggagttgcgttacgtaggtagatcttatgta
aaggcaagtggtagaccagctgatattttggagcggctaaatgagatggccggatttcct
ccgaacgaggagatccagctgtacgaggaaatcaagtttgagccgaatgtcatgtgcgag
cacattgaaaagaagtccactttcaaggctagccagttggaagatggtgatattatctgt
taccagagagctctaacaagggagcaggaattggcttcccggtaccctgacgttccatca
tttttggagtatgttcgcaaccgacagatcgtacattttcgtcgcctagacaaacccaag
gatgacgaattttgtctggaattgtcgaagcaacacacatatgatgatgtggtcgagaag
gtagcagaagaaattaaattggaggacgcgtcaaagatcaggcttacatcacacaattgt
tactcgcagcaaccaaaaccacaacccatcaagtatcggggggttgaaagactaagtgat
atgctcgtacactataatcagacgtcggatattctctattttgagactttggatttgccc
cttcctgagcttcagggtttaaaaaccttgaaggttgccttccacaacgcgaaaacagag
gaggtctcagttcacaatattcgtcttcccaaacaaagtacagttggggatgttgtaaac
gagttaaaggggaaggttgagctttcaagtcctaaggcggagcttcgcattcttgaagtt
ttctatcacaaaatttacaagatcttccccttgagcgagaagattgagaacatcaatgat
caatactggacgcttcgagctgaggaggttcctgatgaggagaaagaacttggtcctcaa
gatcgcttgattcacgtgtatcatttcacgcgtgacgcgtcacaaaattacatggttcaa
aattttggagaaccatttttccttgtggttcgtgagaatgagactttgactgaagtgaag
caacgtattcagaaaaagctagtgatatctgatgaagaattctctaagtggaagtttgcg
tttctttcactgggccgacctgagtatcttcaagatggagatgttgttgctgcccgtttt
cagaaacgagacacttacggtgcatgggagcattatttggggcttgagcatgctgattgt
gcaccgaaacggtcacatactacaaaccagaaccgtcacaacttcgaaaaacctgtaaag
atctataattga

DBGET integrated database retrieval system