KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_216554Help
Entry
PHYPADRAFT_216554 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PHYPADRAFT_216554
Translation factors [BR:ppp03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PHYPADRAFT_216554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 723 aa AA seqDB search
MADVEEAPHSMVPPGTAVEEEQPRIQLNIDWGNVDLDSIVLPPGDDMGIKSDDEEEEEET
LETDTGFGNVIIVDNLPVVASEKYEKLEGVIRKIFGQIGVITPNGLLMPRDESGKTKGYA
FIEYSTPQEAQTAREQTNGYKLDRSHVFVVNMFDDYDKYMKVPDEWNSPEIKPYTPGENL
VAWLTDDRGRDQFVIRFGSETEVYWNNASQGKPDPVYHRTFWTESFVQWSPLGTYLATIH
RQGAAVWGGEKSFNRLMRYIHPQVKLIDFSPGEKFMVTYSSHEPSSHRDTQRVTLMVFDV
RSGKVLREFKGSADDFATGGTGGIAGVSWPVFQWAGGRDDKYFARIGKNAISVYETDTMG
LLDKKSLKVENVVDFCWSPTDPLLSLFVPEGGGGNQPARVSLVSIPSREELRQKNLFSVS
DCKMYWQSNGEYLAVKVDRYTKTKKSTYTGFELFRVKERDIPIEVLELENKNDKIIAFAW
EPKGHRFAIIHGDSPRPDISFYSMKGRVTKLTTLKGRQANALYWSPLGRFIILAGLKAYN
GQLEFYNVDDLETMATAEHFMATDVDWDPTGRFCSTSVTSVHQMENGFNIWSFQGKLLYR
LPRDRFFQFLWRPRPPTLLTPEDEAEIAKNLRKYSKKYEADDLARSLEGTERDTENRRKL
VDEWKSWVAQWKAAQEEEKEERYILRDGVPSDTEEDYEAEEVEVEEIINIEEEVVAFGFD
NQD
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgttgaagaggcgccgcacagtatggtgccgccggggacggcagttgaagag
gaacagcctcgaatccagttgaatatcgattggggcaacgtagacttggactccattgtt
ctgccccctggagatgacatgggtatcaagagcgatgatgaagaagaagaagaagagact
cttgaaaccgatacaggtttcggcaacgtcatcattgtcgataacttgcctgttgtggct
tctgagaaatatgagaagcttgagggtgtcattcgcaagatttttggacaaatcggtgtt
atcactcctaacggacttctgatgccgagagatgagagtgggaagaccaagggttatgcc
tttattgagtacagcactccccaggaagcacagacagcgcgtgagcaaacaaacggttac
aagctcgacagatctcacgtctttgttgtcaatatgtttgacgattacgataagtatatg
aaagtgcccgatgagtggaactccccggaaattaagccatacactcccggcgaaaacctt
gttgcctggctcacagatgaccggggccgggatcagtttgttattcgttttggatccgag
acagaggtttactggaacaacgctagccaggggaagcctgacccagtgtatcatcgcact
ttctggacagagagcttcgtgcagtggtcgccgttgggaacctatctggccaccattcac
aggcagggagctgctgtgtggggaggcgagaaatctttcaatcgtctcatgcgttacatt
catccccaggtgaagttgatcgatttctctccaggagaaaagtttatggtgacgtacagc
agccatgagcccagcagtcatagagatacgcagagggtcactttgatggttttcgatgtt
aggagtggcaaggttctgcgcgagttcaagggcagtgctgacgacttcgctactggtgga
actggcggtatcgctggagtttcatggcctgtgttccaatgggcaggtgggcgtgacgat
aagtacttcgcacgaattggcaaaaatgctattagcgtgtacgagactgataccatgggt
ctgttggataagaaatcgttgaaggtggagaatgtagttgacttctgctggtctccaacc
gaccccttgctgtctctcttcgttcccgaaggtggtggtggtaaccagcccgccagggtg
agtcttgtgtctattcccagcagagaagagttgcgtcaaaagaaccttttcagcgtgagt
gactgcaaaatgtattggcaaagcaacggtgagtacttagctgtgaaggtcgaccgttac
accaagaccaagaagagtacctatactgggtttgagcttttccgtgtgaaggaacgcgac
attcctattgaggttctggaactcgaaaataagaacgataagattatagcatttgcatgg
gagccaaaaggtcaccgttttgcgattatccatggtgatagtcctcgaccagacatttct
ttctactccatgaagggacgtgtgaccaagcttactaccctcaagggtagacaagccaat
gccctgtactggtctccacttggacgcttcatcattcttgcaggtctcaaggcttacaac
ggtcagcttgagttttacaatgtggatgatttggagacaatggcaacagctgagcacttc
atggctacagacgtcgattgggatcctaccggcaggttctgttcaacatcagtaacatct
gttcaccagatggagaacggtttcaatatctggtcattccaaggaaaattgttgtaccgc
ctccctagggacaggtttttccagtttttgtggcgtccaagaccccccacacttcttact
cccgaggatgaggctgagattgccaagaacctgcgcaagtacagcaagaagtacgaggct
gacgatctggcaagatccctggagggtaccgaaagggacaccgagaatcgtcgcaaactg
gttgacgagtggaagtcctgggtggcccaatggaaggcagcacaagaggaggagaaagag
gagcgttacatccttcgtgacggtgtaccaagtgacacggaggaagactacgaagcggag
gaagtcgaagtagaagagatcattaacatagaggaggaagtcgttgctttcgggtttgat
aatcaggactga

DBGET integrated database retrieval system