KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_217391Help
Entry
PHYPADRAFT_217391 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHYPADRAFT_217391
   00052 Galactose metabolism
    PHYPADRAFT_217391
Enzymes [BR:ppp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PHYPADRAFT_217391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 364 aa AA seqDB search
MGVSKGNLTEECVGDGVFLYTLERGGVRAVFTNWGATLMSLCVPDARGEIGDIVLGFDTL
GPYTDGTSPYFGAIVGRVANRIARGTFILDGERFTLPVNNGPNSLHGGYVGFDKVLWEAR
KVTDGNGPSVQFTYHSHDGEQGYPGDLDVSVTYTLSSDCELRTEMEAKPVNKATPVNLAQ
HSYFNLAGHGSGDVLQHRVRLWSTSYTPLDDTQIPTGEIVPVRGTAFDFTEEASIGSRIN
DVPGGYDHNFDLRSGLEDPAGDLHPLNGGDLLGDGLRIAAKVWDPVSRRAMEVFTTAPGV
QFYTGNYVDGIVGKGGAVYNIHAGLCLETQGFPNAVNDSRFPSIIVRPGETYRHVMVHKF
YTQS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgagcaagggcaacttgacggaagagtgcgttggagatggggtgttcctctat
actttggagcgcgggggcgtgcgcgccgtcttcaccaactggggcgccacgctcatgtcg
ctgtgtgtgcctgatgcacgaggagaaatcggtgatattgtcttgggttttgacaccttg
ggcccttacacggatggcacatcaccatattttggagcaatagttggtcgcgttgcaaac
aggatcgcgcgcggcactttcatcctcgatggggagcgcttcacattgccagttaacaat
ggacccaactccctgcatggtggttacgtcgggtttgacaaagttttgtgggaagcgagg
aaggtgacggacggcaatggcccttcagtacagttcacttaccacagccatgacggtgaa
caagggtatccgggtgaccttgatgtctccgtgacttacaccctaagcagcgattgtgag
ctccggacagaaatggaggccaagccagtgaacaaggctactcctgtgaatcttgcccag
catagctattttaatctcgcgggccatggaagtggggatgtgcttcaacaccgtgtgcgg
ttatggagcacaagctacactcccctggacgacacccaaattccaacgggtgaaattgta
ccagttcgaggcaccgcgtttgacttcactgaagaggcatccatcggcagccgcatcaac
gacgtccctggaggatacgaccacaacttcgacctccgaagcggcctcgaagatcctgca
ggggatttgcatcctttgaatggaggtgacttgctcggggatggactccgcatcgccgcc
aaggtctgggaccccgttagcaggcgcgccatggaggtcttcaccacggcacctggagtc
cagttctacaccggcaactatgtggatgggatagttggcaaaggcggagctgtgtacaac
attcacgcaggcctgtgccttgagactcaaggatttcctaatgctgtcaacgactcaagg
tttccttccatcattgtccgccccggtgaaacctacaggcatgtcatggtgcacaaattc
tacacccagtcttga

DBGET integrated database retrieval system