KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_218185Help
Entry
PHYPADRAFT_218185 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHYPADRAFT_218185
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHYPADRAFT_218185
  Amino acid metabolism
   00310 Lysine degradation
    PHYPADRAFT_218185
Enzymes [BR:ppp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PHYPADRAFT_218185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 464 aa AA seqDB search
MAMERALMRLVRAQALRASSSIGVLQRGPVGSASPLQQVREYVVSSSPSDGVSRTDLSES
FISVRQPVWQQWIRRYAAGSGEPGVVVVPFMGESIEDGSLAAILKQPGDAVAVDEIIAQI
ETDKVTIDVRSDVAGKIEEILCKEGDTVKAGTQLARVAVGEAGATSDAPKKEAAPAPPVK
EEEKSAPPLPPKTATASSASPNKDAPSPPKQSSPEPAQPKSISGTEVHMPTKGGERRVPM
TRLRKRVATRLKDSQNTFALLTTFNEIDMSNLMQMRTQHKDLFQEKHGVKLGFMSGFVKA
AVSALKQFPAVNAVIDGDDIIYRDYVDISIAVGTAKGLVVPVIRGADHLNFAQIEKTINT
LGKKANDGSISIDDMAGGTFTISNGGVYGSLISTPIINPPQSAILGMHSIQKRPVVAGND
IVVKPMMYVALTYDHRLIDGREAVLFLRAVKDNVEDPRRLLLDI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggagcgtgctctgatgcgcttggtgcgcgcccaggcgttgcgtgcctcctcg
tccattggggttcttcagcggggaccggttggaagtgcatcgcctttgcaacaggtgcgg
gagtacgtggtgtcgtcgtctccttcagatggtgtctctcgtacggatttgagtgagtcg
ttcatcagtgtaaggcaacccgtttggcaacaatggataagacgttacgcagcagggtca
ggagaacccggagtagttgtagtcccattcatgggggaatctatcgaagatggctctctt
gcagcaattttgaagcaacctggcgatgccgttgctgtggatgagatcattgcccagatt
gaaactgacaaggttacgattgatgtgcgtagtgacgtcgctggaaagattgaagagatt
ctatgcaaagagggagatacagtgaaagccggaacgcaactcgcacgagtagccgttgga
gaggctggagctacgtcggatgctcccaagaaagaagccgctcctgccccccctgtgaaa
gaagaagaaaaatctgctcctccacttcctccaaaaactgcgaccgcttcaagcgcttca
cccaacaaggacgctccatctccacccaaacagtcttccccggagccagcccaacctaaa
tctatcagtggaacggaagtacacatgccaacaaaaggaggagagcgacgggtaccaatg
acccgactacgaaagagagtggccacacggttgaaagattctcagaacacttttgcattg
ttgaccaccttcaacgagattgacatgtctaatctgatgcagatgcgcactcagcataag
gatttgtttcaagagaagcacggtgtgaaattgggatttatgtctggatttgttaaggca
gccgtgagtgcactcaagcaatttcctgctgtcaatgctgtaattgatggagatgacatc
atctaccgagattacgttgacatcagcattgctgttggtacagccaaaggacttgttgtt
ccagtgatccgtggagcagatcatttgaacttcgctcaaattgagaagaccatcaatacc
ctaggcaagaaagcaaatgatgggagcatttcaatagatgatatggctggcggtactttc
actatatccaacggtggcgtctatgggagtctcatcagcactcccattattaacccacca
cagtcggcaattctgggaatgcactcgatccaaaagcgccctgtggtagcaggaaacgac
attgttgtcaagcccatgatgtatgtggccctcacctacgaccaccggctaattgatgga
agagaagctgttctgttcttacgtgcagttaaagacaacgtcgaagatccacgccggctt
ctgttggacatatag

DBGET integrated database retrieval system