KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_218930Help
Entry
PHYPADRAFT_218930 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppp00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 281 aa AA seqDB search
MESVLERLQNDQVTQVGVAIALVAVVAGAAFLYFVNRKKTILVPEKWLKFKCVKKEQVSH
NVVKLRFGLPTPTSVLGLPIGQHISCMGFDSEGTEVVRPYTPTTLDSDLGYFELVVKVYK
EGKVSSYFGRMKEGEYLAAKGPKGRFKYKPNQVREFGMVAGGTGLTPMYQVARAILENSH
DKTKISLIYANVTYEDILLKDDLDRMAAERPDQFKVYYVLNEPPTEWSGGVGFVTKDMIE
RHCPPPAADVQILRCGPPPMNRAIAGHCEALGYTKEMQFQF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgtgttggagaggctgcagaatgaccaagttactcaagtgggcgttgcaatc
gccttggtggcggtcgtcgcaggcgctgccttcctctattttgtgaaccgcaagaagacc
attctcgtacctgagaaatggttgaaattcaagtgcgtgaagaaagagcaggtcagtcac
aatgtggtcaagttgcgattcggcctccccactcccacttcggtgcttggtctcccgatt
ggtcagcacatcagctgcatgggctttgattccgaaggtactgaagtcgttaggccgtat
acccccaccaccctcgattccgaccttggttattttgagcttgttgtcaaggtttacaag
gaagggaaagtgtcgtcttacttcggtcgcatgaaggagggcgagtaccttgccgctaag
ggtcccaagggacgctttaaatacaaacccaaccaagttagagaatttggaatggtggcc
ggtggaactggtcttactcccatgtatcaggttgcaagagcgattctggagaactctcat
gataagactaagatatctttgatatatgcaaatgtcacatatgaggacattttactcaag
gatgatctcgaccgaatggcagcagaacgcccagaccagttcaaagtctactatgttctg
aacgagcccccaacggagtggagtggaggtgtcgggtttgtgacgaaggatatgattgag
agacattgtcctcctccagctgctgatgttcagattctgcgttgtggtcctccacccatg
aacagggccatagcaggccattgtgaagctcttggatataccaaggagatgcaatttcag
ttctaa

DBGET integrated database retrieval system