KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_227546Help
Entry
PHYPADRAFT_227546 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ppp03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 220 aa AA seqDB search
MADELAVTTEALTLDDSKADQVEVGEIVEKPVDRPAEVKKHPLEHSWTFWFDNPGGKQKQ
ATWGSSLRAVYTFHTVEEFWCLYNNVLQPSKLIQGADFHCFKSGIEPKWEDPKCAHGGKW
TAQPPRSGGKAILDTYWLHTLLAMIGEQFDEGDEICGAVVSVRRAQDKIAIWTKTASNEA
AQVSIAKQWKEVLDYNDKLGYLVHEDAKRQDKSAKNRYTV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgagttggcagtgacgacggaggcactgaccttggacgattccaaggccgat
caggtagaagtaggggagattgttgagaagcccgtagatcggccagctgaggtgaagaag
cacccattggagcattcgtggacattttggttcgataacccgggcgggaagcaaaagcag
gcaacatgggggagctctcttcgtgccgtgtatacgttccacactgtcgaagagttttgg
tgcttgtacaacaacgttttgcaacctagcaagctgattcagggtgcggattttcattgc
ttcaagtccggaattgagccaaagtgggaggatcccaagtgtgctcatggtggcaaatgg
actgcgcagcctcctagaagcggcggcaaggctatccttgatacctactggcttcacact
ttgctggctatgattggagagcaatttgacgaaggtgatgaaatttgcggagctgttgtg
agcgtaaggagggcacaagataagattgccatctggacgaagactgcttccaacgaggcc
gctcaggttagcattgcaaagcaatggaaggaggttcttgactataatgacaagctcggc
taccttgtccatgaggacgcaaagagacaagacaagagtgcgaagaacagatataccgtc
tag

DBGET integrated database retrieval system