KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_227829Help
Entry
PHYPADRAFT_227829 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PHYPADRAFT_227829
Exosome [BR:ppp04147]
 Exosomal proteins
  Proteins found in most exosomes
   PHYPADRAFT_227829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1715 aa AA seqDB search
MAAANAPIAMREALTLTSLGINQQFVTFTHVTMESDKYICVRETSPQNSVVIIDMSMPNQ
PLRRPITADSALMNPTSRVLALKALIPGSTQDHLQIFNIELKAKMKSHQMPEQVVFWKWI
SSKLLGLVTQTSVYHWSIEGESTPQKMFDRTANLTGNQIINYRCDPSEKWLVLIGIAPGA
PERPQLVKGNMQLFSVDQQRSQALEAHAASFATFKVAGNDSPSLLIAFSTKTITAGQLTS
KLHIIELGPQPSRPGFAKKAADLFFPPDFADDFPVAMQISSKYNLIYVITKLGLLFVYDL
ETATAVYRNRISPDPIFLTVDAPTTGGFYAVNRRGQVLLATVNESTIVPFVSNQLNNLEL
AVNLARRGNLPGAEGLVVQRFHELFSQMKYKEAADLAAESPKGILRTPDTVAKFQASHPS
VPVQPGQTSPLLQYFGTLLTKGKLNVFESLELSRLVVNQNKKNLLENWLAEDKLECSEEL
GDLVKTVDSDMALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILL
SDPQGAVNFALMMSQLERGCPVDYNVITDLFLQRNMIREATAFLLDILKPNLPEHALLQT
KVLEINLVTFPNVADAILANGMFSHYDRPRIAQLCEKAGLYMRALQHYTELNDIKRVVIN
THAIEPQALVEFFGTLSREWALDCMKELLQVNMRGNLQIIVQVSKEYGEQLGVDSCVKLF
ESFKSYEGLYFFLGAYLSTSEDPEIHYKYIEAAAKTGQIKEVERVTRESNFYPPERTKNF
LMEAKLPDARPLINVCDRHGFVPDLTHFLYVNNMLRYIEGYVQKVNPQNAPQVVGQLLDD
DCPEDFIKGLILSVRSLLAVEPLVTECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKI
IIDTNNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVAYKRGLCDDELINVTNKNSMFKP
QARYVVERMDPELWLKVLDPENPFRRQLIDQVVSTALPESKNPEQVSATVKAFMTADLPH
ELIELLEKIVLQNSAFSGNPNLQNLLILTAIKADKSRVMDYINRLDNFDGPAVGEIAVGA
ELYEEAFAIFKKFNLNVQAVNVLLDHLRDIDRAVEFAARVEEDEVWSQVGMAQLREGLVS
DAIQSFIKANDATQYNEVINVASNVKAYEDLVKYLHMVRKKVKEQRVDSELIYSYARLDR
LGDIEDFIISPNLANLQTVGDRLFDDSLYEAAKIIFTHISNWARLASTLVKIHQYQAAVD
AARKANNSRTWKEVCFACVDAEEFRLAQICGLNVIVQVDDLEEVSQYYQNRGCFVELISL
MESGLGLERAHMGIFTELGTLYAKYRPEKLMEHLKLFVTRINIPKLIRVCDEQQHWQELT
FLYIQYDEYDNAAATMMSHSPEAWDHMQFKDVAVKVANVELYYKATHFYLQEHPEYISDL
LNVLATRIDHTRVVDIMRKAGQLSLVKPYMVAVQSANNAAVNEALNGLYIEDEDYERLRE
SIDMYDNFDQMSMAQRIEKHELLEMRRVAAYVYKRAGRWKQSVALSKKDNLYKDAMETAS
QSGDRDLAEELLTFFVDKGKKECFAACLYTCYDLIRADVAVELAWMHGMMDFCVPYLLPI
FIREYTTKVDDLVKDKIEATEEKRSKESEEKEVVAQQNMYAQLLPLALPPPPVPGVNGFA
PGMGMPTMSGMPPMGGGYGMPPLSGGYGMPSMSSI
NT seq 5148 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagccaacgcccccatcgccatgagggaggcgttaacgcttacaagtctgggc
ataaaccaacaattcgtgacatttacacatgtgacgatggaatccgacaagtacatttgc
gtgcgggagacttctcctcagaacagtgtagtgattatcgacatgtcgatgcccaatcag
cctctgaggcggcctattactgccgattctgcactcatgaatccaaccagtagagttctt
gcgctgaaagctctaattcctgggtcaacgcaagatcacttgcaaatttttaacattgag
ttaaaggcgaaaatgaaatcgcatcagatgccagaacaggtagtgttttggaagtggatt
tcttcaaaattactagggcttgttacacaaacctcagtatatcattggtccatagaaggt
gaaagtacaccacagaagatgtttgacagaactgcaaatttgactggtaaccaaatcatc
aactatcggtgtgatccctctgaaaagtggctagtattgattggtattgcccctggtgca
cctgagcgcccacagcttgtgaagggaaacatgcaattattttctgtggatcaacagagg
agtcaagcattagaagcgcatgcagcatcattcgcaacttttaaggtggcaggaaacgac
tcaccaagtcttcttattgcattctcaacaaaaactataactgctggacagcttacatcc
aagctgcatatcattgagcttggtcctcaaccaagtagacccgggtttgccaagaaggcg
gcggacttgttttttcctccggattttgcagacgattttccagttgcaatgcagatctca
tcgaagtacaatcttatctacgttatcacaaagctgggccttctttttgtctacgatcta
gaaaccgctacagctgtgtacagaaaccgtatcagtccagatcctatctttttgacagtt
gatgcaccaacaactggtggattttatgctgtcaatcgccgcggacaagttctactggcg
actgtaaatgagtcaacaattgttccattcgtcagcaatcagctgaacaatttggagctt
gcggtgaatctggccagacgagggaatttgcctggagccgagggcttggttgtgcaacgt
ttccacgagttgttttctcaaatgaaatacaaggaagcagctgaccttgcagctgaatca
ccaaaaggaatacttcgaactccagatacggtggccaaatttcaggcaagtcacccaagt
gttccagtgcagcccggacaaacgtcgccacttttgcagtacttcggaactttgctgaca
aagggcaaattgaatgtgtttgagtccttagagctttcccggttggttgttaatcaaaac
aagaagaacctacttgagaactggttggcggaagacaaactcgagtgcagtgaagaactc
ggagatcttgtcaagaccgtagacagtgatatggctttgaaaatttacataaaggccagg
gctacacccaaggtggttgcagcttttgctgagcggcgagagtttgataagattctgatt
tactccaagcaggttgggtatacaccagattatctgttcctgctgcagacaatactgcta
tcagatcctcagggtgctgtaaactttgctctgatgatgtctcagttggaaagaggatgt
ccagtagactataatgttatcactgacttgttccttcagcgcaacatgatcagggaggca
accgcgtttcttttggatattctgaagcctaatttaccggagcatgccctacttcaaacc
aaggtactggagatcaatttggtcacatttcccaatgtggctgatgcaattctggcgaat
ggcatgttctcccattatgatcgtcctcgcattgctcaactctgtgagaaagctggtctc
tacatgcgtgcccttcagcattacacagagttgaatgatatcaagcgtgttgtgatcaac
actcatgctattgaacctcaggcgctagtggagttttttggaactttgtctagggagtgg
gccttagactgcatgaaggagcttctccaagtgaatatgcgagggaatcttcaaattatc
gtgcaggtttcgaaggagtatggggaacagctgggtgttgattcttgtgtaaagttgttt
gagagcttcaaatcatacgaaggcctttacttcttccttggcgcatacttaagtacaagc
gaggaccctgagatccactacaagtacattgaggctgcagcaaagactggccaaatcaag
gaagtggaacgtgtcacaagagagtccaacttctatcctcctgagaggaccaaaaacttt
ttgatggaagcaaagttaccagatgcaaggcctctcatcaatgtttgcgatcgacatggc
tttgtgccagatcttactcatttcctttatgtcaacaatatgcttcgatatattgaagga
tatgtgcagaaggtcaatccacaaaacgcacctcaggtggttgggcaattgcttgatgat
gattgccctgaggacttcattaagggtttgatcttatccgtccgctcactgcttgctgtt
gagcctctggtcaccgagtgtgagaagaggaatcgtctgcgactgttgacacaattctta
gagcatttggtaagtgaaggtagccaagatgtgcatgtgcacaatgctcttgggaagatc
atcatagatacaaacaataatcctgagcattttctcactacaaatccttactacgactca
aaagttgttggtaagtactgtgagaagcgcgaccccacactcgcagtggttgcatacaaa
cgaggtctgtgtgatgatgagcttatcaatgtaacgaacaagaactctatgttcaagcct
caggccaggtatgtggttgagcgtatggatcctgagctatggttgaaggttctcgaccca
gaaaatcccttcaggagacagctcattgatcaagtcgtttctactgcactgccagagagc
aagaatccagaacaggtgtcagccactgttaaggcattcatgactgcagatttgccccat
gagttgatcgaacttctagagaaaattgttctacagaactctgccttcagtggcaacccg
aatctccagaacctgctcattctcacagcaatcaaggctgataaatcaagggttatggac
tatatcaaccgattggataattttgatggtccagcagtgggggaaattgctgttggtgct
gagctttatgaggaagcatttgctatatttaagaagttcaacttgaacgtgcaagctgtc
aatgtcctcttggaccacctccgcgacattgaccgtgctgtggaatttgcagcacgagtg
gaagaggatgaggtctggagccaggtgggtatggcacagttgagagaagggctggtaagt
gatgccattcaatctttcatcaaggctaacgatgctacccagtacaatgaagttataaat
gtggcatccaatgtcaaagcttacgaggatcttgtcaaatacttgcatatggttcggaag
aaggtgaaggaacagagggtggactcggaattgatttattcctatgctagacttgatcga
ttgggtgatattgaggatttcattatttctcctaaccttgcgaatctgcaaaccgttgga
gaccgactctttgatgactccttgtacgaagctgccaaaatcatatttactcacatctcc
aactgggctagactggcgagcactcttgtcaaaattcatcagtatcaagcagctgtggat
gcggctcggaaggccaataactcacggacttggaaggaagtgtgtttcgcttgtgttgat
gctgaggaatttcgattagcgcaaatctgcggtcttaatgtcattgtccaggtggacgac
ttggaagaagtcagtcagtactatcagaacaggggttgttttgtggagcttatctctctt
atggagagtgggcttgggctggagcgtgcacacatgggaatattcacagaacttggaacg
ctttatgcgaaataccggccagagaagcttatggagcatctcaagctttttgttacccgt
attaatattccaaaacttatccgcgtttgcgacgagcaacagcactggcaggaacttaca
ttcttgtatattcagtatgatgagtatgacaatgccgctgctactatgatgagccattct
cctgaggcttgggatcacatgcagttcaaggacgtggctgtgaaggtagccaatgtggaa
ttgtactacaaggctactcacttctatctgcaggagcatccagagtacatcagcgatctt
cttaatgtcctagctactcgaatagatcatacaagggtggtagacatcatgcggaaggct
ggacaattatcactggtgaaaccatacatggtggctgtacagagtgctaacaatgctgca
gtgaatgaggctctcaatggcttatacattgaagatgaggattacgaacgactcagagag
tccattgatatgtatgataactttgatcagatgtcaatggcacagcggattgagaagcac
gaacttctggaaatgcgacgagttgcagcttacgtctacaagagggctgggagatggaaa
cagtcggtcgctctttctaagaaggataacttgtacaaggatgccatggaaaccgcctca
caatcaggcgatcgtgatcttgctgaggaattgcttaccttctttgtggacaagggcaag
aaagaatgctttgctgcatgcctatacacctgttacgatctcattcgtgctgatgttgcg
gtggagctcgcctggatgcatggcatgatggatttttgtgttccttatttattaccaatt
ttcattcgtgagtatacaacaaaggttgatgaccttgtcaaggataaaattgaagcaact
gaagaaaagaggtcgaaggagtccgaagagaaggaggttgtggcgcaacagaatatgtat
gcccagcttttgcctttagctctacctcctcctcctgttcctggtgtgaatggctttgcg
cctggcatgggcatgcctaccatgagtggtatgccacctatgggtggaggttacggcatg
ccccccttaagcggagggtacggtatgcctagtatgagttcaatctaa

DBGET integrated database retrieval system