KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_228841Help
Entry
PHYPADRAFT_228841 CDS       T01041                                 

Gene name
PLC6
Definition
PLC6 phospholipase C protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ppp00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ppp04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 666 aa AA seqDB search
MTIIGCECVLPRPNVLQHTPPEIVKTMFHEAAQGKNYMNALDFATFLEKVQGQKGLDEHQ
VASLVTQTVLSAIAGFHFSISVQSVQLDLLGFSNYLVNAKLNPPISDTDIMYIDSLKINH
IFQPTHDMTRPLSHYYIYASHNSYLTGNQLTSSSSIVPIIEALRNGCRVIELDCWEKQGQ
QCWSGSTNNDIVVLHGNTLTSAIPFKDCVIAIKENAFIASQYPVIITIENHMGAEMQKKA
ALVLREILGESLFYPSREQRPPLQFESPEVLKGFIIVSDQPPSDTIEDQLAVDPNAAQVL
ATDELDDAHASTSDHTRHAQRLKKHIKRAHKKAVLRVANTAAKVLRKSLLVEKIEVPETV
EFQELIYLYCAKPSEMKKAKHEEGPLVGGDRAIMANLSEPQLQHFIARHPGSLIEYSKMN
LGRVYPFGLRFNSSNADPMLAWSHGFQIAALNLQGRDRPVWLAKGFFQVNGHTGYVKKPD
IFLPGFSLSHEDILNLPIKMILRVTVLLGTNWHRNFDFFKNPDFYVKVAVHGVKNDASKR
QTQVIYNCIEPHWEHEHFEFPLRVPEIAVLRLECWEWDMGNHDFVGQACLPVRELRYGIR
SVALRSKSGASRSSKLLCHFQSFAVSSLAPPSELPHPHPGPPSSPPPLPPPVAPEEPQPP
PPSSCT
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgacaattattggatgtgagtgtgtacttccaagaccaaatgtactccaacacactccg
ccggagattgtgaaaaccatgtttcatgaagctgcacaaggaaagaattacatgaatgct
ttggattttgcaacatttttggaaaaggttcagggacaaaaaggattggatgaacaccaa
gtggcctcattggtcacacaaactgttttgagcgcaattgctgggttccatttctccatc
tctgtgcaaagtgtgcaactggatctattagggttttcaaactacttggtgaatgccaaa
ttgaaccctcccatttcagacacagatattatgtatatagattcattaaaaatcaaccat
attttccagcccacacatgacatgacaaggccattgtcccattattacatttatgcaagt
cacaattcatacctaactggcaaccaattaacttcctcatcaagcattgtgccaataata
gaggctcttcggaatggatgtcgagtcattgaacttgattgttgggaaaaacaagggcaa
caatgttggagtggctctaccaacaatgacattgtggttctccatggcaatacattgaca
agtgccatccccttcaaagactgtgtaatagcaataaaagagaatgcatttatagcatcc
cagtatccagtgatcatcacaattgaaaaccacatgggagctgaaatgcagaagaaagct
gctctagtgctgcgtgagattttgggtgagagtctgttctatccttccagagagcaaagg
cctcctcttcaattcgaatcacctgaagtcttaaagggtttcatcatcgtatcagatcaa
cctcccagtgatacaattgaagaccaactggcagttgatcctaatgcagctcaagtcctg
gccacggacgaactggacgacgcgcacgcatcgacgagcgaccacacgcggcacgcgcaa
cggctgaagaagcacatcaagcgagcgcacaagaaggcggtcctgagggtggccaacacg
gcggcgaaggtgctgcggaagtcattactggtggagaagatcgaggtgccggagacggtg
gagttccaggagctgatctatctgtactgcgcgaagccctcggagatgaagaaggccaag
cacgaggagggccctctggtgggcggggaccgggcgatcatggccaatctgagcgagcct
cagctgcagcacttcatcgcccgccatcccggctctctcattgaatattcaaagatgaat
ttggggagagtgtacccatttgggttgcggttcaactcatccaatgcagatccaatgttg
gcatggagccatggcttccaaattgctgcgctcaatctccaagggagagaccgcccagtt
tggttggccaaaggcttcttccaagtcaatggacacacgggttatgttaaaaagcccgac
atttttttgcctggtttttcactctctcatgaagatattctaaatttgcccataaagatg
attctgagggtcacggtattgttaggaacaaattggcatagaaactttgacttcttcaaa
aatcctgatttttatgtaaaggttgctgtgcatggtgtgaaaaatgatgcaagcaagcga
caaacccaagtcatctacaactgcattgaaccccactgggaacacgagcacttcgagttc
cctctccgagtgccggagatagcggtgcttcggctggagtgctgggagtgggacatggga
aaccatgacttcgtcgggcaggcgtgcctgcccgtgagggagctgcgctacggcattcgc
tccgtggcgttacgctccaagtccggcgcctcccgctcctccaagctcctctgccacttc
cagtccttcgccgtctcctccctcgctcccccctcggaacttcctcaccctcaccctggg
cctccgtcgtctcctcctccccttccccctcctgttgcacctgaagaacctcagcctcct
cctccttcctcctgcacctga

DBGET integrated database retrieval system