KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_228849Help
Entry
PHYPADRAFT_228849 CDS       T01041                                 

Gene name
snf1a
Definition
snf1a Snf1-related kinase SNF1a
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:ppp04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 542 aa AA seqDB search
MEAGGRPMGPATAEYYLPNYKLGKTLGIGSFGKVKVAEHSPTGHKVAIKILNRRKVKMMD
MEEKVRREIKILRLFMHPHIIRLYEVIETPADIFVVMEYVKSGELFDYIVEKGRLGEHEA
RRFFQQIVSGVEYCHRNMVVHRDLKPENLLLDSKSNVKIADFGLSNVMRDGHFLKTSCGS
PNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGSLPFDDENIPNLFKKIKGGIYTLPSH
LSPGARDLIPRMLLVDPMKRVTIPEIRQHPWFLNHLPRYLAVPPPDTTQQAKRIDEEILE
RVVALNFDRDLLIDSLLNRVQNKATVAYYLMLDNRRRLSNGYLCSEFNEGKEHLMSPMDA
FNGTPRSGYPRTLTHMSSMDRRSASPSGLQHRVVAERKWVLGLQLRSHPKEIMNDVLKTL
RDLGINWKKTGAYNLKCRWVAPGQNSNDTTAENHSLPDSPMAGSMPRASSCRWSSEQHGV
SGSVAAGNRDNESGVESNVLKFELQLFKLREEKYLLDLQRVVGPTYLFLDLCAAFLAELR
VL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaggtggccggcccatgggtcctgctacagcggagtactatttgcccaactac
aagctggggaaaaccctagggattgggtctttcgggaaggtgaaagtggcagaacattca
cccactggccacaaggtggctattaaaattttaaatcgacggaaagtcaagatgatggac
atggaggagaaagtgcggcgtgagatcaagattttgcgactattcatgcatccccacatc
atacgcttgtacgaagttatcgagacaccggcagacatatttgtggtgatggaatatgta
aaatcaggggagctgtttgattacattgttgagaagggacgtctaggtgaacatgaagct
cgacgatttttccagcagattgtgtccggagtggagtattgtcatcggaacatggtagtt
catcgtgacttgaagccagagaacttacttcttgattccaagtctaacgtcaagattgct
gattttgggttatccaatgttatgagggacggtcatttcctcaaaactagctgtggaagt
ccaaattatgctgctccagaggtcatttcagggaagttatatgccggtcccgaggtggat
gtgtggagctgtggcgttattctgtatgctcttttgtgtggttctttaccctttgacgac
gaaaacattccaaatctgtttaagaaaatcaagggtggcatctacactctgcctagtcat
ttatcaccaggagcaagagatctcattccaagaatgttgcttgtagacccgatgaagaga
gtaacaattcctgagattcggcagcatccatggtttttaaatcatttgccccgttacctt
gcagttccccctcctgatacaactcagcaagctaaacggattgacgaggaaatattggag
cgggttgttgcattgaattttgatcgggacctacttattgactcactgctaaaccgcgtg
caaaacaaggccactgtggcatattatttgatgctggacaaccgtcggcggctttcaaat
ggttatctttgctctgaattcaatgagggaaaggagcacttgatgtctccaatggatgca
tttaacgggacgccaagatctggttatcctcgaactttaacccacatgtctagtatggac
cgaagaagtgcatcgccctctgggctacaacatagggttgtagctgagaggaaatgggtt
ttaggtctccagttacgatcacaccctaaagagataatgaatgacgttttgaagaccctc
cgcgatctgggcatcaactggaagaagacaggggcttacaacttgaagtgccgatgggtt
gcaccaggccaaaattcgaatgacacgactgcagagaatcatagccttcctgattcccca
atggctggatctatgcctagagcttcttcttgccgctggtcttctgagcagcacggagtt
tctggttcagtggctgctggaaacagagataacgagagtggcgtcgagagtaatgtcctc
aagtttgaattgcagctcttcaagttgcgagaagagaagtatttgctggacctgcaaaga
gtagtgggtcccacatatctctttctcgacctatgcgcagctttcctagcggagttacgg
gtgctgtga

DBGET integrated database retrieval system