KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_228852Help
Entry
PHYPADRAFT_228852 CDS       T01041                                 

Gene name
snf1b
Definition
snf1b Snf1-related protein kinase SNF1b
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    PHYPADRAFT_228852 (snf1b)
Enzymes [BR:ppp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PHYPADRAFT_228852 (snf1b)
Protein kinases [BR:ppp01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   PHYPADRAFT_228852 (snf1b)
Mitochondrial biogenesis [BR:ppp03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    PHYPADRAFT_228852 (snf1b)
  Mitophagy factors
   Other mitophagy factors
    PHYPADRAFT_228852 (snf1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 545 aa AA seqDB search
MDSGGRPVAPVAVEYYLPNYKMGKTLGIGSFGKVKVAEHTPTGHKVAIKILNRRKVKSMD
MEEKVRREIKILRLFMHPHIIRLYEVIETPTDIFVVMEYVKSGELFDYIVEKQRLGEDEA
RRFFQQIVSGVEYCHRNMVVHRDLKPENLLLDSKWNVKIADFGLSNIMRDGHFLKTSCGS
PNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGSLPFDDENIPNLFRKIKGGIYTLPSH
LSPGARDLIPRMLLVDPMKRVTIPEIRQHPWFLNHLPRYLAVPPPDTLQQAKRIDEEILE
RVVALNFDRVHLIESLLNRVQNKATVAYYLMLDNRRRLSNGYLGSEFDEGKEQSLSPMSP
YGAHGGTPRSTYPRSLIRTPSMDRRGSSSSVLQHRVVAERKWALGVQLRSHPKEIMSDVL
DTLRKCDINWKKTGAYNLKCRWVAPNQHLNDRASEHRGIPDSPMAGTTPRVSSGRWSSEQ
QGISGSVASGNKDDESGVESNVLKFELQLFKMREEKYLLDLQRVEGPTYLFLDLFSAFLI
ELRVA
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggactccggtggaaggcccgtggctcctgtagccgtggagtactatctgcccaactac
aagatggggaaaaccctagggattgggtctttcgggaaggtgaaggtggcagagcacact
cccaccggccataaggtggccattaaaattttaaatcgacgaaaagtcaagtcgatggac
atggaagagaaagtccgacgcgagatcaagatattgcggctattcatgcaccctcacata
atacgcttgtacgaagttattgagacaccaacggacatctttgtggtcatggaatacgtg
aaatcaggagaactgttcgattacattgttgaaaagcagcgtctaggtgaagatgaagct
cgacgatttttccagcagattgtgtctggcgtggaatattgccatcggaatatggttgtt
catcgtgacttgaagccagagaacttacttctcgactccaaatggaacgtcaagatagct
gatttcggactgtccaatattatgagggatggtcactttctcaaaactagttgcggaagc
cccaattatgctgctccagaggttatatcagggaagctctatgccggtcctgaggtggac
gtctggagctgtggcgttattctgtatgctctcttgtgtggctcgttgcccttcgacgac
gaaaatattccgaatttgtttaggaaaatcaagggtggcatctacactctgcctagccat
ttatcaccaggagcaagggatcttattccaaggatgttgctggtagacccaatgaagcga
gtaaccattcctgagattcggcagcatccttggtttttaaatcacttgcctcgttacctt
gcggttcctcctcctgatacattacagcaagctaagcgaattgacgaggaaatcctggaa
cgggtagttgcgttgaattttgaccgggtacaccttatagagtcactgctcaaccgcgtg
cagaacaaggcaacggtagcatattatttgatgctggacaatcgtcggaggctatcaaat
ggttaccttggctctgaatttgatgaaggaaaagagcaatcgttgtctccaatgtcaccc
tatggtgcacatggcgggactccaaggtctacctatcctagatctttaatacgcactcct
agtatggatcgaagaggttcatcttcctccgtgctacaacacagggttgtcgctgagagg
aaatgggctctaggtgttcagttacgatcacatcccaaggagataatgtctgatgtttta
gataccctcaggaagtgtgatatcaactggaagaagacaggtgcctacaatttgaaatgt
cgatgggtagctccaaaccaacaccttaacgacagggcctcagaacatcgtggtattcct
gattccccaatggctggaactacacctagagtttcgtctggccgctggtcttctgagcag
cagggaatctctggttcagtggcgtctggaaataaagacgacgagagtggcgttgagagc
aatgtcctcaagtttgaattgcagctcttcaagatgcgagaagagaagtatttgctggac
ctgcaaagagtggagggccctacctatctcttcctcgacttgttctcagcttttcttatt
gagttacgggtggcttga

DBGET integrated database retrieval system