KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_229935Help
Entry
PHYPADRAFT_229935 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Tyrosine metabolism
Betalain biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    PHYPADRAFT_229935
  Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    PHYPADRAFT_229935
Enzymes [BR:ppp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     PHYPADRAFT_229935
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PHYPADRAFT_229935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 261 aa AA seqDB search
MLPDGFYQFFSFLRAITSPATKFEGVVGDGREKALLKHVLISADNDSPDSVLEAVNDFCK
RTWLMCIGDEKGALLDSCVLHRNPRVALELGAYCGYSATRIASQMKEPASMLISLEMNAT
NVDTARQLINHAGFSSRERTSDSHSAFAEGLSSRVRVINGVLSEKLQELRNILNSLKTNI
FEFVFIDHNKDSYLSDFLLLKENGLIGKGTVIVADNMKFPGSPKYRRYLRKHSEEFETVE
LKCAFEYISWLPDSLMVSTWK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctgatggattttatcagttcttcagcttcctgcgggcaatcacaagccctgcg
accaagttcgagggagtcgtcggagacgggcgagagaaagcattgctcaagcatgtcctc
atcagcgctgacaacgacagccccgactctgtcctcgaagccgtcaacgatttctgcaaa
agaacgtggctcatgtgcatcggagacgagaaaggcgccctcctggattcctgtgtgctc
cacagaaacccgcgggtagcactcgaactaggcgcttactgtggctactctgcgacccga
atcgcctcacagatgaaggaacccgcaagcatgctcatcagtctcgagatgaacgccacc
aatgtggacaccgcacgccagcttattaaccacgcaggcttctcgtctcgtgaacgcaca
tctgatagtcatagtgcatttgctgaaggtttgtcgtcgcgagtgcgagtgattaacggg
gtgctcagcgagaagctgcaagagcttagaaacatactcaactccttgaagacgaacatt
ttcgagtttgtgttcattgaccacaacaaggactcctacttgtccgacttcttgctactc
aaggagaatgggctcattggcaagggcaccgtcatagtggctgataatatgaagtttcct
ggttcacccaagtaccgccgctacttacgaaagcactccgaagagttcgagactgtggag
ttgaagtgcgcgtttgagtacatttcgtggctgccagacagtctcatggtgtcaacctgg
aagtga

DBGET integrated database retrieval system