KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_231066Help
Entry
PHYPADRAFT_231066 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PHYPADRAFT_231066
Enzymes [BR:ppp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PHYPADRAFT_231066
Exosome [BR:ppp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PHYPADRAFT_231066
  Exosomal proteins of colorectal cancer cells
   PHYPADRAFT_231066
  Exosomal proteins of bladder cancer cells
   PHYPADRAFT_231066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 607 aa AA seqDB search
MASKHRRELVICLLSFLFLLVISNLSQITAESRESGGDSGLEEVVDSIGEEEGEGYEGYD
ATDGDENVDHGNGEDEEDDDEEEEDEEGEDGEDQGWKGIDETDVVVLGSHNFTAFVTKEP
YVMVEFYAPWCGHCQELAPEWAAAATALKRRVPVAKVDATAHPEISDKFGVTGYPTLFFF
IDGVPTPYSGERAKDAIIQHVNKKMNVTVIPLTSKSDVEALLEPKSPIAIAYIDNLEGAD
VEELTSAARQEENVKFYMTNDADVAAMLGLGTESKPALVLLKNVPDKRLVYEDDFKRKPL
YEFVSANKLPLVIYYKEESIKLVFENVIKNQVICFINGEEHWGVAQSVFEKVARMFRGQT
LFIRANLADKEGQQAAQYFGISGENPIIVICRTLLLSKGIELQFRVIVILNLKYVIGFIF
LQIMAYVSVEEGPKYLYEGEFTVTGVKGFVEGFLANTLPPYYKSEPIPELNNEDVKIAVG
KNFEEVVLDESKDTLLELYAPGCNYCQELEPTYKKLAKRLRDIPSISIVKMDGLTNEHPR
AKPDGYPTILFFPAGKKSFEPITFEGDRTVKGFYQFIKKNAAIPFTLQKSGKSKATKKCA
ENMKDEL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaaaacatcggcgcgagctcgtgatctgcctcctatcgtttctgtttcttctt
gtgatatcaaatttgagccaaatcactgcagaatcgagggaaagtggtggagattcgggt
ctcgaggaagtggtagactccatcggggaggaagagggggagggctatgaaggatatgac
gcaaccgatggagatgagaatgtggaccatgggaatggtgaggatgaagaggacgatgac
gaagaggaagaagacgaggaaggagaagatggggaggatcagggctggaaggggattgac
gaaacagatgttgttgtgcttgggtcgcacaacttcacggcgtttgtaacgaaggaacca
tatgttatggtagaattttatgcaccttggtgcggacattgtcaggaattggcacctgag
tgggccgcagcggccaccgctctgaagcggcgcgttcctgtggcgaaggtcgacgcaacc
gcgcatccagaaattagtgacaagtttggcgtgactggttaccctacgttgttcttcttc
atcgatggcgtgccgacgccttactccggcgagcgggcgaaggacgccatcatacaacat
gtgaataagaagatgaatgtaactgttataccactaacgtcaaaatctgatgttgaggct
ttgttggaacctaagtcgccaatcgcaattgcatatattgacaacttggagggtgctgat
gtggaggaattgacatctgcagcaaggcaggaagaaaacgttaaattctacatgactaac
gatgctgatgtggctgctatgcttggacttgggactgaatccaaacctgctttggttctt
ttaaagaacgttccggataaacgtttagtctatgaggatgatttcaaaaggaaaccactt
tacgaatttgtgtcggcaaataaactgcctcttgtgatctactacaaagaagaatcaatc
aagttagtctttgagaatgtcatcaaaaatcaagtcatttgctttattaatggtgaggag
cattggggtgttgctcaatcagttttcgagaaagttgcaagaatgttcagagggcagacg
ttgtttatacgtgccaatctggccgacaaggaagggcagcaagctgctcaatattttggc
atttcgggggaaaatcctatcatagtaatatgtcgtaccctgctgttgtctaaaggcata
gagttgcagtttcgagtgatagtcattttaaatctgaagtacgtcattgggttcatcttt
ctacaaataatggcatatgtgtcggttgaggaaggtcccaagtacttgtacgaaggcgaa
ttcactgttacaggagtcaagggttttgtggaaggttttctagcaaacactttgccacct
tattacaagtcggaaccaatccctgaactgaacaatgaagatgtgaagatagccgttggc
aaaaacttcgaggaggtagttcttgatgaatctaaggatacccttcttgagctgtatgct
cctgggtgcaattattgtcaggagttggaaccaacatacaagaaactagccaagcggttg
agagacattccctctatttcaattgtgaagatggatgggctaacaaacgaacatcctcgt
gcaaagcccgatggctatccgactattcttttctttccagctgggaagaagagctttgag
ccaatcacattcgagggtgacagaacagtgaaaggtttctatcaatttattaaaaagaat
gcagctatcccatttacactgcaaaaatctggtaagtccaaagctacaaagaagtgtgca
gaaaatatgaaggatgaactatga

  All links  
No link information was found.   
DBGET integrated database retrieval system