KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_231607Help
Entry
PHYPADRAFT_231607 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:ppp04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 691 aa AA seqDB search
MENYLHECVRSSLRAYLYANATFLCERLCAEFPSESNVHLLATCYFRSNKAHQAYHVLKG
TKSRQCRYLFALACMEMQNLEEAEAALLSSLEPGAESQPSSAASYYLLGVICKQSDRRQG
AIGHYTQALSLDPFLWSAYEDLCGLGAEEEAASVFSDAASFQLQKVEFLGQLNAMQNEHD
DNDYSLRTPVSSNGSPKHRRLHSGGAVSDAGSAFMTPTSEGMCTPAPVPNLGLGLPGPGR
STNPSASPAGGGAGEGVGRGGGGTVGYAQQRRKFVDPDGKFRKSLRSLSMRPGYTQIPGR
LFEQGAPRRSTATLHYEKLFDSFEVSGGVDEGLSNSKLEGAEEEAPLSARCISRGASELF
QLLRILGEGYRHLCMLRCQEAVQSFSKLPQQHFATAWVLCQVGRAYLEMVNYAEAERVYS
WARRVSPHCSEGMDMYSTALYHMKKDVQLSYLAQDAVAMDRLSPQAWCVMGNCFSLQKDH
ETALKFFQRALQLDPNFTYAHTLCGHEYVAMEDFEEGLTCYRKAIRLDSRHYNAWYGLGT
IYFRQEKYELAEYHFRRALFVNSRSSVLHCYLGMALHALKKNGEALALLEQAIVADPKNP
LPKFQRANVLMSEGRCHEALAELEELKELAPRESSVFFLMGRIYKRLDMLERAIHHFCIA
LDLKPSATDVNLIKTAIEKLPIADDLEVENL
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggagaattatctgcacgagtgtgttcggtcgtctttgcgtgcgtacttgtacgcgaat
gctacattcctgtgtgagcgcttgtgtgcggagtttccctcggagagtaatgtgcacttg
ctggcaacgtgctatttccggagcaacaaggcacaccaggcttatcatgttctgaaaggt
accaaatcgcggcaatgtcgatacctatttgcactggcgtgcatggagatgcaaaatttg
gaagaggcggaagcggcattgttaagttcattggaaccaggtgctgagtcgcagcccagt
tcagcagcgagctattatctactgggcgtcatttgcaagcagtcggatcgaaggcaggga
gcaattgggcattacacgcaagcgttgtctctggatccgtttctttggtctgcatacgag
gatttgtgtggccttggagcggaagaggaagctgcctccgtgttcagcgatgcagcaagt
tttcagctacagaaagttgagttcctcgggcaattgaatgcgatgcagaatgagcatgat
gataatgattattcgcttcgtacccctgtgtccagcaatggcagccctaagcataggagg
ctgcattccggtggtgctgttagcgatgcagggagtgcgttcatgactccaacgtccgag
ggtatgtgtacccctgcgcctgttccgaacttagggttgggacttccaggaccgggtcgt
agtaccaacccgagtgctagccctgcgggagggggagcaggtgagggagttggaagagga
ggtggagggacagttgggtatgcgcagcagcgacggaagtttgttgatcccgatggaaaa
tttcgtaagagcttgcgatcgctttccatgcgcccagggtacacccaaatacctggaagg
ctcttcgagcagggggcacctagaaggagcacagcaaccttgcactacgagaaactgttt
gacagcttcgaggtttctggaggcgtggacgaggggctgagtaattccaaattggaaggt
gcggaagaggaggcaccactgtcagctcgatgcatctcgcgtggagcttcggaattattc
cagctgttacggattttgggggaagggtatcgtcatctgtgcatgcttcgttgccaagaa
gctgttcaaagcttttccaagctacctcaacagcattttgcgactgcctgggtgctttgt
caagtgggaagagcgtacttggaaatggttaattatgctgaggcggagcgtgtatacagc
tgggcgcgacgtgtctccccacactgctcagagggaatggacatgtattcaacagcgctt
tatcatatgaagaaagatgtgcagttgagttatttagcacaagatgccgttgctatggac
cggttgtcgccgcaggcatggtgtgtgatggggaactgttttagtttgcagaaggatcac
gaaactgcattgaagttcttccaacgagctcttcagttagatccgaatttcacttacgca
catactctttgtgggcacgaatatgtagcgatggaagattttgaggagggtctcacctgc
taccgcaaagctattcggctcgattcccgtcattacaatgcttggtatggactgggtact
atctactttcggcaagagaagtatgagctagctgagtaccactttcgaagagctctcttc
gtgaattcccgctcttcggtgttgcattgctatctgggcatggcattgcatgcactgaag
aagaatggcgaagctttggctttgttggagcaagcaatagttgcagacccgaaaaaccct
ctcccaaagtttcaaagagccaatgtgttgatgagcgagggacgttgccatgaggcgctg
gcagagctggaggagctgaaggaactagctccacgggagagtagtgtcttctttctgatg
ggtcgaatatacaagcgattagacatgctagaacgtgctatccatcatttttgcattgct
ctagacttgaagccatcggctacggacgtgaatctaattaagacagccatcgagaagttg
ccaattgcagatgatctcgaggttgagaatttgtag

DBGET integrated database retrieval system