KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_234776Help
Entry
PHYPADRAFT_234776 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHYPADRAFT_234776
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PHYPADRAFT_234776
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PHYPADRAFT_234776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 338 aa AA seqDB search
MDVAASRVGGEKIHGSSCQNLCAFWEEGQQRVVEASLTLVRELARLKADHVRKRGGSIAT
SCMLGVPLGHNSSFLQGPAFSPPRIREAIWCGSTNSTTETGKQLEDVRVLTDVGDVPIQE
MRGCGIGDEVLMRTITDSVKLVMDEPPLRPLVLGGDHSISFPVVRGVSEFLGGPVDILHI
DAHPDIYHAFEGKHYSHASPFARIMEGGHARRLIQVGLRSITQEQRDQAKKFGVEQHEMR
NFDQHREKLQNLHLGEGVKGVYISIDVDCLDPAYAPGVSHIEPGGLSFRDVLNIVQTVKG
DIVGCDVVEFNPQRDTVDGMTAMVAAKLVRELCAKMSK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgcggcgtcacgagtcggcggcgagaagattcacggctcctcgtgtcagaat
ttgtgtgcattttgggaagaggggcagcaacgcgttgtggaggcctctctgacgctggtg
cgggagcttgcgcgcctcaaggctgatcatgtgcgcaagcggggaggctccattgccact
agctgtatgctcggagtccccttgggtcacaattcatcgtttctccagggtcctgcattc
tctcctccgaggatccgagaggctatctggtgcggcagcaccaactccaccacagaaaca
gggaagcaattggaggatgttcgagtgttgacagatgttggtgatgtgcccatccaagag
atgcgagggtgcggcataggcgacgaggttcttatgcgcacaatcacggattcggtgaag
cttgtgatggacgagccaccgctgcggcccctcgtgttgggaggagatcattccatttcg
tttccagtggtgaggggtgtctctgagtttctcggtgggccagtcgacatcctccacata
gatgcccaccctgacatttaccatgcctttgaaggcaagcattactcccatgcctccccg
ttcgcccgcatcatggaaggcgggcatgcgaggcggcttatacaagtgggcttacgctca
ataacgcaggagcaacgcgaccaagctaagaagtttggagtggagcagcatgaaatgcgg
aatttcgaccagcaccgggagaagcttcaaaatctgcatctcggcgagggcgtgaaaggg
gtgtacatctcaattgatgtggattgtctcgacccagcgtatgcccctggagtttcccac
atagaaccgggtggtctctctttccgagacgtgctgaacatcgtgcagaccgtgaagggt
gacattgtcggctgcgatgttgtggagttcaacccacaacgggacactgttgatgggatg
actgccatggtcgccgccaagcttgtacgcgagctgtgtgcgaaaatgtccaagtga

DBGET integrated database retrieval system