KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_234776Help
Entry
PHYPADRAFT_234776 CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppp01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppp00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 338 aa AA seqDB search
MDVAASRVGGEKIHGSSCQNLCAFWEEGQQRVVEASLTLVRELARLKADHVRKRGGSIAT
SCMLGVPLGHNSSFLQGPAFSPPRIREAIWCGSTNSTTETGKQLEDVRVLTDVGDVPIQE
MRGCGIGDEVLMRTITDSVKLVMDEPPLRPLVLGGDHSISFPVVRGVSEFLGGPVDILHI
DAHPDIYHAFEGKHYSHASPFARIMEGGHARRLIQVGLRSITQEQRDQAKKFGVEQHEMR
NFDQHREKLQNLHLGEGVKGVYISIDVDCLDPAYAPGVSHIEPGGLSFRDVLNIVQTVKG
DIVGCDVVEFNPQRDTVDGMTAMVAAKLVRELCAKMSK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgcggcgtcacgagtcggcggcgagaagattcacggctcctcgtgtcagaat
ttgtgtgcattttgggaagaggggcagcaacgcgttgtggaggcctctctgacgctggtg
cgggagcttgcgcgcctcaaggctgatcatgtgcgcaagcggggaggctccattgccact
agctgtatgctcggagtccccttgggtcacaattcatcgtttctccagggtcctgcattc
tctcctccgaggatccgagaggctatctggtgcggcagcaccaactccaccacagaaaca
gggaagcaattggaggatgttcgagtgttgacagatgttggtgatgtgcccatccaagag
atgcgagggtgcggcataggcgacgaggttcttatgcgcacaatcacggattcggtgaag
cttgtgatggacgagccaccgctgcggcccctcgtgttgggaggagatcattccatttcg
tttccagtggtgaggggtgtctctgagtttctcggtgggccagtcgacatcctccacata
gatgcccaccctgacatttaccatgcctttgaaggcaagcattactcccatgcctccccg
ttcgcccgcatcatggaaggcgggcatgcgaggcggcttatacaagtgggcttacgctca
ataacgcaggagcaacgcgaccaagctaagaagtttggagtggagcagcatgaaatgcgg
aatttcgaccagcaccgggagaagcttcaaaatctgcatctcggcgagggcgtgaaaggg
gtgtacatctcaattgatgtggattgtctcgacccagcgtatgcccctggagtttcccac
atagaaccgggtggtctctctttccgagacgtgctgaacatcgtgcagaccgtgaagggt
gacattgtcggctgcgatgttgtggagttcaacccacaacgggacactgttgatgggatg
actgccatggtcgccgccaagcttgtacgcgagctgtgtgcgaaaatgtccaagtga

DBGET integrated database retrieval system