KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_24215Help
Entry
PHYPADRAFT_24215  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
ppp  Physcomitrella patens subsp. patens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 344 aa AA seqDB search
GLMNLGNTCFFNSVMQNLVGVSMLREYFSKEPSVQEGDGDDDSKSASARTMRTRSFGANV
GNAVSPTRLFSAICAKAPRFKGFQQQDSHELLRCLLDGLHMEEESARKAQLSAESPTEPN
GTVKEEGSHGNPIKVPVTFVEHVFGGQFSSTVSCCVCGHSSVVYEPFLDLSLPIPSAREV
YTYPMMSLEGCLQAFTKTEVLSGENAWGCENCAKVERNATKRFLISKAPRVLTVHLKRFA
QDLHGRLSKLSGHITFHEQLDLGPFTDKGWDGVYQLIGTVEHSGTMRGGHYVAYVKGSVN
YEESEADDSPKGASTWYYISDSHVRKTSLEAVLQSEAYLLFYER
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gggttgatgaatttgggaaacacttgcttttttaattcggtgatgcagaatttggttggc
gtgagtatgcttcgggagtatttcagtaaagaaccatctgtacaagaaggagacggagat
gacgacagtaagagtgcatcagccagaacgatgaggactaggtcctttggagccaatgtc
ggtaatgctgtaagtccgacaagactattctctgctatttgtgcaaaagctccaaggttt
aaggggttccagcagcaagacagtcatgagctcttaagatgcttgttagatggactgcac
atggaggaagagagcgcgcggaaggcccaacttagtgcagaatcacccactgaacctaat
ggcacagtgaaagaggaaggaagccatggaaacccaatcaaggtgcccgttacgtttgta
gagcacgtgtttgggggtcagttttcaagcaccgtgtcttgttgtgtatgtggtcactcg
tcggttgtttacgagccttttctagatttgtctttgccaattccgagtgctcgtgaagtg
tacacttatcccatgatgtcacttgaaggctgtttgcaggctttcacaaagactgaggtc
ctgtcgggagagaatgcttggggttgtgaaaactgcgccaaggttgagcgtaatgcaact
aaaaggttccttattagtaaagccccacgcgttctcactgtgcatttaaaacgatttgcc
caagatttgcatgggcgactgagcaagctaagtggccatattacctttcatgagcagctc
gatcttggccctttcacagacaaagggtgggatggcgtgtaccaattaattggtactgtg
gagcactcgggaacaatgcgaggtgggcattacgtcgcttatgtgaaaggttctgttaat
tacgaggagagtgaggcagacgattctcctaagggagcctcgacatggtactacatcagt
gattcacatgtccggaaaacaagtttggaagccgtgctgcaaagtgaagcctatctgctg
ttttacgaaagg

DBGET integrated database retrieval system