KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_3037Help
Entry
PHYPADRAFT_3037   CDS       T01041                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ppp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppp00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ppp00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppp00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 422 aa AA seqDB search
VESKIREIFMPALSSTMTEGKIVSWVKNEGDKLSKGESVVVVESDKADMDVETFYDGFLA
KIVITEGETAPVGAAIGLLAETEEEIAEAKAKAQATTPVAAQPSPVEEKVLSPPTPVATP
APVVAVQVPTEPVAPTAPRSGRIIATPYAKKLAKQYSVDLASVAGSGPGGRVTPADVEAA
AGKTPAPIASPVVQASAAAPFGSVAFTSMQVGVARNMVESLSVPVFRVGYTVTTDALDAL
YKKIKSKGVTMTALLAKACALALEKHPVVNASCKDGKSFTYNEDINIAVAVAMDGGLLTP
VLKNPNKVEIYSLSRSWKDLVDKARAKQLSPAEYSSGTFVLSNLGMFNVDRFDAILPPGV
GAIMAVGASTPTVVATGDGLFSVKNRMTVNVTADHRIIYGGDLAVFLQTFAAIIEDPKDL
TL
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtggaatcgaagatccgagagattttcatgccggcgctgagctcgactatgacggagggc
aagattgtgtcgtgggttaaaaacgagggcgacaagctgagcaaaggtgaaagcgtggtg
gtcgtggaatcggacaaggctgatatggacgtggagacattctacgatggattcttggcg
aaaattgtgattacggaaggcgaaaccgcacccgtgggagccgcaattgggctgcttgcg
gagaccgaggaggagattgctgaagcgaaggcgaaggcacaggcaacaacacctgtagcc
gctcaaccctcacctgtagaagaaaaggttctttcccctcccactcctgttgctacccct
gcccctgtcgtggctgtccaggtccccacggagcccgttgctcctacagcacccagatcg
ggcagaattattgccacgccctatgcgaagaagcttgcaaagcagtacagcgtagatctt
gccagtgtagcaggctctggacctggtggtcgtgtcacacctgcggatgtggaggctgcg
gctggcaagactcctgcccctatcgcctcacctgtggtgcaagcttcggctgcggctcct
tttggttctgttgcatttacatcaatgcaggttggcgttgcccgcaacatggtggagagt
ttgtccgttcctgtattccgtgttgggtacactgttaccactgacgcgcttgatgccctg
tacaagaagatcaagtcgaagggtgtgacgatgacagctctattagccaaggcgtgtgct
cttgctttggagaagcaccccgttgtgaatgccagctgcaaggatgggaaaagcttcacc
tacaacgaagacatcaacattgctgtcgccgttgccatggacggtggtctgctcacgcca
gttctgaaaaatcccaacaaggtcgagatctattcattgtctcgctcctggaaggacctt
gtcgacaaggctcgcgcaaagcaactttcgccagctgaatatagctctggcacgtttgtt
ttgtcgaaccttggaatgttcaatgtcgaccgatttgatgccattctgccccctggagta
ggtgcgattatggcagtcggagcatctactcccacggttgttgccactggagatggcctg
ttcagtgtgaagaataggatgacggtgaatgttaccgcagaccacagaatcatctatggc
ggtgacctagctgtgtttttgcaaacctttgcagctatcattgaagaccccaaggatctg
acattg

DBGET integrated database retrieval system