KEGG   Physcomitrella patens subsp. patens: PHYPADRAFT_31656Help
Entry
PHYPADRAFT_31656  CDS       T01041                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ppp  Physcomitrella patens subsp. patens
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PHYPADRAFT_31656
   00500 Starch and sucrose metabolism
    PHYPADRAFT_31656
Enzymes [BR:ppp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PHYPADRAFT_31656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 493 aa AA seqDB search
VCQATSYPATCAQTLASGNYTADSKGVTRYSLQSAETGVNSTLSSILRLNRTNPNVTAAL
EVCDEVLELSKEQLEAAISVLGGSNSTATKKVMDDLKSWVSAAMELHTTCIDALLEVSPE
DGKRIEQDSAHTQELLSNALAFINALATYGDKIQNWKLTGLLSTTDSLPGWMDAQTKRHL
LQAPTYDVVVAQDGSGDFKTIQEAVNAHKENSARLVIYIKSGTYNEQVTVPKTAKYLTFI
GDGDKTIITGSRNVALMKGMTTFKSATLIVSGDGFIGRSFKVENTAGAEGHQAVAFRGTA
RLIAMYQVTFDSYQDTLYAHSFRQYYRDCTVYGTVDFIFGNAEASFQNCKIIAKRSTLLG
QQNTYTAQGRTDPQMTTGFSFQNCVFDGTPELKANTTFYKTFLGRPWKAYSVCVLLKSEV
LAHVDPSGWMPWNTTTFGLYTSYFAEYQSFGAGADTSKRVSWSHQITSASTAQTYQANNF
VGASSWVPSYNLP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtttgtcaagcgacgtcgtatcccgctacctgcgctcagacgttggctagtgggaactac
acggccgactcaaagggggtgacgaggtattccttgcaaagtgcggaaacaggagtgaat
tcaactttatcatcgattttgagattgaataggacaaatcccaacgtaactgctgcactg
gaagtttgtgatgaagttctggagctgagtaaagagcagctggaggcggctataagtgta
ctaggggggtctaattcgacggcaacaaagaaagtgatggatgacttgaaatcttgggtg
agcgcggccatggaactgcacactacgtgcatcgatgcgctcttggaggttagccctgaa
gacggtaagcggatagaacaggattcggctcacacccaggagctcctaagcaatgcttta
gcgtttattaacgcgctggctacttatggagacaagatccagaactggaaactaacgggg
cttctgtccactacagacagtcttcctggatggatggatgctcagacgaagcgccatctc
ttgcaagctcccacgtacgacgtggtggtggcgcaggatggctccggagattttaagaca
attcaggaagcggtgaacgctcacaaggagaacagcgcccgtttggtgatttatatcaaa
tcgggtacgtacaacgagcaagtgaccgtgccgaaaactgccaagtacttgacgttcatc
ggcgatggcgataagaccatcatcacgggaagtcggaacgttgcgctaatgaaggggatg
accactttcaaatccgcaactctgatcgtctcaggggatggttttatcggccggtcattc
aaggtggagaacactgctggagctgaaggccaccaggccgtagcattcagagggacggca
aggttgatcgccatgtaccaagtaacattcgacagctaccaagatacgctctacgcgcac
tctttccggcaatactatcgcgactgcaccgtctacggcacagtggacttcatctttggc
aatgccgaggcttccttccagaactgcaagataattgcgaaacggtcgactttgctcggg
cagcagaatacatacactgcgcaaggcagaaccgacccgcagatgaccacggggttctcc
ttccagaactgcgtttttgacggaaccccggaactcaaggcaaataccactttttacaaa
accttcttgggccgaccctggaaagcttattctgtatgcgttctgttgaagtcggaggtg
ctggcgcacgtcgatccctcggggtggatgccttggaacacgactactttcggcctgtac
acctcctacttcgccgagtaccagagttttggtgcaggcgctgacactagcaagcgagtg
tcttggtcgcatcagatcacctccgcgagcactgcgcagacgtaccaagcgaacaatttc
gtgggagccagctcctgggtaccgagttacaaccttccg

DBGET integrated database retrieval system